Navigation Links
iGuard Transforms Drug Safety Alert and Update Process
Date:10/4/2007

are at greater risk for dangerous drug interactions that may cause serious and even life threatening side effects. Millions of people are in this category and senior citizens are especially vulnerable to this phenomenon. iGuard provides a risk rating system to help people learn about drug interactions and other dangerous effects.

Dr. Judith Jones, MD., Ph.D., President and CEO of the Degge Group, Ltd., a drug safety research company, says, "Drug safety is front and center on the public health radar screen, and iGuard provides a unique, patient-centered solution in real-time."

About iGuard

iGuard is a wholly owned subsidiary of Quintiles Transnational Corp. and is the fastest and easiest way for patients to get information and safety updates on the drugs they are taking. This drug safety monitoring program facilitates bi-directional exchange of timely and relevant information, enabling patients to take an active role in managing their health. iGuard maintains an efficient communication channel where patients and health professionals can monitor, evaluate and share information about drug risks and benefits. Registration is free online at http://www.iguard.org.

About Quintiles

Quintiles Transnational Corp. is powering the next generation of healthcare by providing a broad range of professional services in drug development, financial partnering and commercialization for the biotechnology and healthcare industries. With 19,000 employees and offices in more than 50 countries, it is focused on providing customer-centric solutions that are the gold standard of the industry. For more information, please visit the company's Web site at http://www.qtrn.com. Available Topic Expert(s): For information on the listed expert(s), click appropriate link. Hugo Stephenson

SOURCE iGuard
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Reforming FDA: Focus on safety, let market judge efficacy
2. Funds will support public safety communications interoperabilty
3. High interest forces delay in food safety symposium
4. Human factors and IT: Designing for patient safety
5. UW Medical Foundation CEO shares his vision on the state of health care and patient safety
6. UW symposium to explore impact of IT on improving quality, safety and cost of healthcare
7. Thompson receives leadership award for technology solutions for patient safety
8. Einstein Wireless launches cellular alert system
9. Technology played key role in E. coli alerts
10. Wisconsin firm leads testing of alerts by cell phone
11. MyWeather-powered alerting system surpasses 165,000 downloads
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... /PRNewswire-Asia-FirstCall/ -- Genesis,Pharmaceuticals Enterprises, Inc. (OTC Bulletin ... pharmaceutical company with its principal operations in ... it engaged KPMG Huazhen,("KPMG"), a member firm ... firms,affiliated with KPMG International, to assist the ...
... & Company, LLC, a,Boston-based life science investment bank, ... joined the firm as senior advisor. In ... on internal and client-related activities including,merger & acquisition ... focus on biopharmaceutical transactions. "We are delighted ...
... PTNEW YORK, Jan. 13 Keryx Biopharmaceuticals, Inc. (Nasdaq: ... Weiss, the Company,s Chairman and Chief Executive Officer, is ... Healthcare Conference being held in San Francisco.Mr. Weiss, presentation ... 1:00pm PT and will be accessible from the Investor ...
Cached Biology Technology:Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 2Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 3Keryx Biopharmaceuticals to Present at the J.P. Morgan 27th Annual Healthcare Conference 2
(Date:9/23/2014)... Fruit and vegetable consumption could be as good for ... , The research, conducted by the University of Warwick,s ... England, and published by BMJ Open focused ... mental wellbeing were consistently associated with an individual,s fruit ... mental wellbeing ate five or more portions of fruit ...
(Date:9/23/2014)... infant chimpanzees from their mothers are well documented, little ... of early life experience. In a year-long study, scientists ... that those who were removed from their mothers early ... performers are likely to show behavioral and social deficiencies ... in the open-access journal PeerJ , was led ...
(Date:9/22/2014)... GAINESVILLE, Fla. --- Many native species have vanished ... University of Florida scientists have discovered how fossils ... , The key lies in organic materials found ... ancient ecosystems functioned, according to a new study ... the Journal of Herpetology . Pre-human island ...
Breaking Biology News(10 mins):Eating five a day may keep the blues away 2Chimpanzees raised as pets or performers suffer long-term effects on their behavior 2Answer to restoring lost island biodiversity found in fossils 2
... New findings from a landmark clinical trial show that although ... to develop age-related macular degeneration (AMD), a potentially blinding eye ... do not predict how patients will respond to Lucentis and ... "wet" form of AMD. This new data from the Comparison ...
... change to current dosages for sleeping medications in women ... that flu dosages for women be reconsidered as well. ... common practice, but we aren,t there yet. To accelerate ... education and clinical training, the Sex and Gender Women,s ...
... from engineers at Rensselaer Polytechnic Institute and the University of ... powerful new tool for manipulating cells. Results of the study, ... blue light can be used as a switch to prompt ... process of clustering, or oligomerization, is commonly employed by nature ...
Cached Biology News:Major clinical trial finds no link between genetic risk factors and 2 top wet AMD treatments 2Sex and gender competency essential to medical care 2Nature Methods study: Using light to control cell clustering 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: