Navigation Links
CureFAKtor Pharmaceuticals Featured at University of Florida Innovation Showcase 2011
Date:4/19/2011

ted results and expectations expressed in these forward-looking statements. These statements are based on current expectations, forecasts and assumptions that are subject to risks and uncertainties, which could cause actual outcomes and results to differ materially from these statements.  

Media Contact

Rx Communications Group, LLC
Eric Goldman
Vice President, Public Relations
917-322-2563
egoldman@rxir.com


'/>"/>
SOURCE CureFAKtor Pharmaceuticals, LLC
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4

Related biology technology :

1. Keryx Biopharmaceuticals, Inc. to Hold Conference Call on Second Quarter 2008 Financial Results on Monday, August 11, at 8:30 A.M. EDT
2. ISTA Pharmaceuticals Reports Second Quarter 2008 Financial Results
3. SGX Pharmaceuticals Announces Financial Results for the Three and Six Months Ended June 30, 2008
4. ADVENTRX Pharmaceuticals to Report Second Quarter 2008 Results
5. Merrimack Pharmaceuticals Initiates Enrollment in a Phase 1 Study of MM-121, an ErbB3 Antagonist
6. VIA Pharmaceuticals to Present at Fourth Annual Noble Financial Equity Conference
7. Anthera Pharmaceuticals Completes $19 Million Financing; Appoints Christopher S. Henney as Chairman
8. Access Pharmaceuticals to Present at the Noble Financial Equity Conference
9. Indevus Pharmaceuticals Announces Issuance of U.S. Patent for SANCTURA XR(TM)
10. XTL Biopharmaceuticals Receives Notice of Non-Compliance with Nasdaq Marketplace Rule Due to Changes in Board Composition
11. Lotus Pharmaceuticals Announces Second Quarter 2008 Results
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Today DuPont Executive Vice President James C. Borel ... greatest challenge facing our time – ensuring food security ... at the International Food and Agribusiness Management Association ... students to contribute their time and talents to create ... collaboration with others. , “Food is one of the ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/19/2013)... Adding to their already extensive supply ... Simport’s Dropette® and Heathrow Scientific disposable plastic ... basic biology, chemistry and any type of liquid handling ... 35 years, Simport has been supplying the science community ... the Simport Dropette®. Simport’s Dropette® is a one-piece ...
(Date:6/18/2013)... New York, NY (PRWEB) June 18, 2013 ... technological innovation and sustainability, the Consulate General of Switzerland ... largest solar boat, Switzerland’s MS Tûranor PlanetSolar , ... as part of its DeepWater Expedition 2013 tour with ... catamaran, led by Capitain Gérard d’Aboville, runs exclusively on ...
Breaking Biology Technology:DuPont Leader Calls for New Generation of Food Visionaries to Fight Hunger 2Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: