Navigation Links
Yongye International Announces Branded Store Network Increases Over 40% to 5,000 Stores
Date:8/3/2009

BEIJING, Aug. 3 /PRNewswire-Asia-FirstCall/ -- Yongye International, Inc. (OTC Bulletin Board: YGII; "Yongye" or the "Company"), a leading developer and distributor of Shengmingsu branded plant and animal nutrient products located in the People's Republic of China, today announced that the number of independently owned, branded stores selling Yongye's Shengmingsu branded products increased to approximately 5,000 as of June 30, 2009, up from 3,500 as of the period ended March 31, 2009.

Yongye's network of branded stores are integral to the unique marketing strategy that has allowed the company, working with its distribution partners, to rapidly penetrate the rural market and promote strong brand recognition for Yongye and the benefits to farmers of using Shengmingsu to enhance crop yields and improve their incomes.

The Company's distributors work with each store owner to feature Yongye products in a prominent fashion, display brochures and advertisements for Company products, and transform the store front to prominently feature Yongye's brand name so it is highly visible from the street. Yongye branded stores are supported by intensive banner advertising and product support at the village level that drive awareness among farmers of Yongye's products and drive increased traffic to the independently-owned stores.

The Company attributes much of the increased demand for its Shengmingsu branded products to its successful marketing strategies, tightly integrated advertising campaigns and effective branding efforts across its channels. Yongye promotes its products nationally and regionally through activities such as national commercials on CCTV-7, China's national agriculture television channel, and local agriculture television channels and newspapers.

"The rapid growth in our branded store network in 2009 reflects the success of our channel partner training and development programs and
'/>"/>

SOURCE Yongye International, Inc.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Yongye Biotechnology International Receives License to Manufacture Products
2. Yongye Biotechnology International Raises $ 9.0 Million In Private Placement, Raises Guidance
3. Yongye Biotechnology Distributor has Record Breaking Single Store Sales Day
4. Yongye Biotechnology Announces Preliminary Results for its Fiscal Quarter Ended March 31, 2009
5. Yongye Biotechnology Appoints New Chief Financial Officer
6. Yongye Biotechnology Announces Preliminary Results for Fiscal Year 2008
7. Yongye Biotechnology to Host Virtual Retail Road Show to Provide Overview of the Company in English and Mandarin
8. Yongye Biotechnology International to Expand its Network of Branded Stores
9. Yongye Biotechnology to Present at Roth Conference
10. Yongye Biotechnology Announces Record Third Quarter Results
11. Yongye Biotechnology to Present at Roth Capital China Comes to Vegas Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Children,s Health International Medicine Project of, Seattle (CHIMPS) Presented at Academic ... ... Los Angeles, CHELMSFORD, Mass., April 22 El Salvador, like ... issue of major public concern. This past fall, the El Salvadoran,government ...
... Groups of febit,s ... MEDFORD, Mass., and HEIDELBERG, Germany, April 22 febit,holding ... to,the U.S. market at RNAi World Congress, which will take ... main user groups of febit,s new device,will benefit from the ...
... AMSTERDAM, Netherlands and SANTA CLARA, Calif., April 22 ... rapidly evolving field of molecular,diagnostics, and Agilent Technologies, ... which they intend to collaborate to develop new ... an agreement in,which Agendia products will continue to ...
Cached Biology Technology:ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 2ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 3ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 4febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 2febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 3Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 2Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 3
(Date:6/17/2015)... Maryland , and HILDEN, Germany , ... QGEN ; Frankfurt Prime Standard: QIA) today launched new ... evidence in forensic laboratories in the United States ... solution to simultaneously analyze multiple key genomic markers (short tandem ... ® Quality Sensor to evaluate the quality of DNA ...
(Date:6/17/2015)... GARDENS, Fla. , June 17, 2015 /PRNewswire/ ... solutions, today announced that its U.are.U ® ... Togo,s Eateries, Inc., a ... casual sandwich chain, to increase security, improve accountability ... fingerprint readers enable instant, non-repudiable identity confirmation for ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 2Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 3Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
... change is one of the major challenges facing the international ... had a significant impact on the distribution of the sea ... the Arctic. There is a close connection between the Arctic ... Denmark at present is due to the polar front extending ...
... be performed successfully in 95 percent of young children ... the February 2013 issue of OtolaryngologyHead and Neck ... procedure with varying reported success rates ranging between 35 ... success in children is often perceived as lagging behind ...
... recent article in the Chronicle of Higher ... announced it was considering anonymity in the review ... ) Ge Wang, adjunct professor of biomedical ... Forest University School of Biomedical Engineering and Sciences ...
Cached Biology News:Aarhus University builds research station in North Greenland 2Aarhus University builds research station in North Greenland 3Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 2Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: