Navigation Links
YM BioSciences Reports Fiscal First Quarter 2011 Operational and Financial Results
Date:11/11/2010

href="http://content.prnewswire.com/designimages/favicon_PRN.ico" type="image/x-icon" />
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/20/2014)... OR (PRWEB) October 20, 2014 Local ... participate in an investigational study of donor stem cells ... in stem cell therapy and has performed clinical stem ... this study is to determine if a single injection ... affected joints can help reduce pain and inflammation in ...
(Date:10/19/2014)... NextCODE Health, which enables clinicians and researchers to use full ... the launch of its new genomic data analysis and collaboration ... of Human Genetics (ASHG) annual meeting in San ... for free beta access, visit www.nextcode.com . A brief ... here . The Exchange: , ...
(Date:10/19/2014)... The Asia-Pacific Speech Analytics market report defines and ... and forecast of revenue. This market is estimated to ... by 2019, at a Compound Annual Growth Rate (CAGR) ... the TOC of the Asia-Pacific Speech Analytics market report ... It also provides a glimpse of the segmentation in ...
(Date:10/19/2014)... The report "Unmanned Ground Vehicle Market by Application ... & by Geography - Forecasts & Analysis 2014–2020", ... market into various sub segments with an in-depth ... also identifies the factors driving this market, various ... adoption trends. , The unmanned ground vehicle market ...
Breaking Biology Technology:Cascade Veterinary Referral Center Seeks Candidates for an Investigational Study of Stem Cells for Dogs with Arthritis 2The NextCODE Exchange: The first global, real-time system for sharing full-resolution genomic data 2The NextCODE Exchange: The first global, real-time system for sharing full-resolution genomic data 3The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 2The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 3The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 4Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 2Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 3Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 4Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 5
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: