Navigation Links
Xceed Molecular to Launch New Inflammation Xpress Chip(TM)for the Ziplex(R) Automated Gene-Expression Analysis System at Clinical Lab Expo 2008, Booth 2155
Date:7/29/2008

ee-dimensional matrix of these channels as target solutions pass through. The chip is made of porous silicon with microchannels that extend from the upper to the lower surface of the chip. Capture reagents are attached to the walls of distinct groups of microchannels ("spots") and target molecules are captured as sample flows through the channels. Multiple capture reagents are deposited in a grid to permit parallel analysis of up to 484 spots per chip ("features"). This approach facilitates the interaction between target molecules and immobilized probes, resulting in hybridization times that are three- to four-times faster.

Xceed offers two types of TipChips - preconfigured (Xpress Chips) and custom (Autograph Chips(TM)). Xceed's preconfigured Xpress Chips (like the new Inflammation Xpress Chip) contain published genes of interest for common pathways or disease processes. They provide a ready-made solution, for research only, to assess specific transcript profiles. Xceed offers several preconfigured arrays. Xceed's Metabolic Xpress Chip offers genes of interest for investigators exploring metabolic pathways and can be used to investigate differential expression associated with diseases of the metabolic system, such as obesity, muscle disorders, and other metabolic disorders. Xceed also offers the Breast and Colon Cancer Xpress Chips, and we have a number of other TipChip arrays in development for a range of cancers, including prostate, lung, and melanoma. Xceed manufactures custom Autograph Chips with the customer's specific gene signatures of interest. Each array is ideal for focused disease biomarkers comprising up to 120 genes, allowing for three replicates per probe. Focused content allows cost-effective analysis of relevant markers in disease-process research investigations.

About Xceed Molecular (http://www.XceedMolecular.com)

Xceed's vision is to advance molecular diagnostics by su
'/>"/>

SOURCE Xceed Molecular
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Kiwa Bio-Tech Revenues for 1st Half Exceed $3.25 Million
2. CrossFire Beilstein Database Exceeds Ten Million Compounds
3. CNCA Exceeds Standards in Nutritional Supplement Quality, Protects Public
4. Center for Molecular Medicine Offers Xceed Ziplex(TM) Services to Research Community
5. AMDL Signs 100 Strategic Cooperation Agreements in China for Its JPGreen Clinics; Gross Sales Per Each Location Could Exceed $400,000
6. Cephalons 2007 Results Exceed Full Year Sales and Earnings Guidance
7. Osteotech Reports 2007 Full Year and Fourth Quarter Financial Results; Full Year Revenue of $104.3 Million Exceeds $100 Million Milestone; Diluted Earnings Per Share Was $.15 in 2007
8. Kiwa Bio-Tech Year-End Revenues Increase 264% - Exceed $9.1 Million
9. Xceed Molecular Features Ziplex(R) Automated Gene-Expression System at the Biomarker World Congress, Booth 16
10. Xceed Molecular Grants Gen-Probe License to Xceeds Flow-Thru Chip(R) Technology for Multiplex Molecular Diagnostics
11. Center for Molecular Medicine Only Regional Provider of Test Suggested in FDA Alert on Prescribing Codeine to Nursing Mothers
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... ... January 22 , - First-Ever Young Women ... Elsevier announced today the winners of the Asian Young ... and citation database of peer-reviewed literature,and the Third World Organisation for Women in ...
... LEXINGTON, Mass. , and HEIDELBERG, Germany , ... at Children,s Hospital Boston chose febit,s HybSelect technology which will ... of genes of interest for resequencing. In January the core ... to perform HybSelect. , "We feel that febit,s HybSelect technology ...
... ... product offering, PrescriberPRO Mobile. ,PrescriberPRO Mobile is a state-of-the-art smart phone application ... medical prescribers. The application will provide names, addresses, and other account information on ... ...
Cached Biology Technology:Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 2Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 3Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 4Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 5Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 6Scopus(R), TWOWS and TWAS Announce Young Women Researcher Award Recipients in Asia 7Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 2Molecular Genetics Core Facility at Children's Hospital Boston Selects HybSelect from febit for Targeted Resequencing 3Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 2Healthcare Data Solutions Announces New Mobile Application, PrescriberPRO Mobile 3
(Date:8/29/2014)... from the University of Texas Medical Branch at Galveston has ... antibodies can completely protect monkeys against a lethal dose of ... time when the disease is severe. , Thomas Geisbert, professor ... Nature discussing advances in Ebola treatment research. The filoviruses ... most deadly of pathogens, with fatality rates of up to ...
(Date:8/29/2014)... This news release is available in German . ... are key players in the natural nitrogen cycle on ... these specialist bacteria were thought to depend on nitrite ... scientists led by Holger Daims, a microbiologist at the ... can use hydrogen as an alternative source of energy. ...
(Date:8/29/2014)... nucleus, chromosomal DNA is tightly bound to structural ... chromatin. Until about two decades ago, histones were ... material around which the glamorous DNA strands were ... appreciation for how DNA/histone interactions govern gene expression. ... studying the sequence of the genome from cancer ...
Breaking Biology News(10 mins):Leading Ebola researcher at UTMB says there's an effective treatment for Ebola 2Hydrogen powers important nitrogen-transforming bacteria 2Hydrogen powers important nitrogen-transforming bacteria 3'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 2'K-to-M' histone mutations: How repressing the repressors may drive tissue-specific cancers 3
... The bird enthusiast who chronicled the adventures of a ... of Telegraph Hill" knows most of the parrots by name, ... one bird from another. While it has been known for ... our day-to-day environment, the underlying neural mechanism has been less ...
... reduce age-related macular degeneration ,(AMD) which is the major cause ... the third cause of global blindness, according to,a study published ... There are two types of AMD, wet and dry. ... loss. A team of researchers across seven European,countries and co-ordinated ...
... New Zealand mud snail currently inhabits four of the five ... to a Penn State team of researchers. These tiny creatures ... food replacements for the native species. "These snails have an ... Levri, associate professor of biology at Penn State,s Altoona Campus. ...
Cached Biology News:Distinguishing between 2 birds of a feather 2Distinguishing between 2 birds of a feather 3Eat oily fish at least once a week to protect your eyesight in old age 2Tiny invasive snail impacts Great Lakes, alters ecology 2Tiny invasive snail impacts Great Lakes, alters ecology 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: