Navigation Links
WuXi PharmaTech (NYSE: WX) Holds Its Third Life Science and Chemistry Awards Ceremony in Beijing
Date:12/22/2009

nd Technology of China -- Dr. Yuanying Jiang, Dean of the School of Medicine at Second Military Medical University -- Dr. Jijie Cai from the National Institute of Biological Sciences, Beijing -- Dr. Xiang Gao, Vice Dean and Professor of the Medical School of Nanjing University -- Dr. Zehong Miu from the Shanghai Institute of Materia Medica of the Chinese Academy of Sciences -- Dr. Shaorong Gao from the National Institute of Biological Sciences, Beijing -- Dr. Xuechu Zhen from the Shanghai Institute of Materia Medica of the Chinese Academy of Sciences -- Dr. Jianguo Chen, Executive Vice Dean of the Research and Development Office and Director of the Department of Pharmacology of Tongji Medical College at Huazhong University of Science and Technology -- Jie Tang from the Institute of Biophysics of the Chinese Academy of Sciences

"I am honored to receive the WuXi PharmaTech Life Science and Chemistry Award," said Dr. Yongfeng Shang, the First Prize Winner. "This award recognizes my research work and inspires me to delve deeper into the study of pharmaceutical research and development. As a leading pharmaceutical, biotechnology, and medical-device research and development outsourcing company, WuXi PharmaTech founded this award to encourage scientists working in pharmaceutical research and development and to promote basic scientific research and innovation related to life science and chemistry. I will continue to spare no efforts to make my contributions to the life science industry."

Han Qide, Vice Chairman of the Standing Committee of the National People's Congress, and Mr. Zhang Huaixi, Vice Chairman of the Tenth Chinese People's Political Consultative Conference, attended the awards ceremony, presented the awards, and congratulated the winners, encouraging them to continue their contributions to China's pharmaceutical research and s
'/>"/>

SOURCE WuXi PharmaTech (Cayman) Inc.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. WuXi PharmaTech Selects Labcyte POD(TM) 810 Platform for High-Throughput Screening
2. WuXi PharmaTech Named in Deloitte Technology Fast 50 China 2009 List for the Fifth Consecutive Year
3. Quest PharmaTech Acquires Late-Stage Immunotherapeutic Antibody Pipeline
4. WuXi PharmaTech Announces Second-Quarter 2009 Results
5. WuXi PharmaTech Announces Shareholder Resolutions Adopted at 2009 Annual General Meeting
6. WuXi PharmaTech Schedules Second-Quarter 2009 Earnings Release
7. WuXi PharmaTech Receives Award from BASF
8. WuXi PharmaTech Named a Top Ten Chinese Outsourcing Enterprise
9. WuXi PharmaTech Appoints Felix Hsu as Senior Vice President of U.S. Operations
10. WuXi PharmaTech Appoints Wei-Min Chang as Vice President of Operations and General Manager of SynTheAll Manufacturing Facility, Eric Gu as Vice President of Business Development for Manufacturing Services
11. WuXi PharmaTech to Present at Third Annual Jefferies Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Workshop Set for Sept. 3, UPPSALA, Sweden and ... Bernard de Bruyne, M.D., Ph.D., will present the,benefits of ... the outcomes of multivessel PCI in a workshop at ... The EBAC-accredited,workshop, which is sponsored by Radi Medical Systems, ...
... Cepheid (Nasdaq:,CPHD) will present at the Thomas Weisel ... Hotel, Boston, September 5 to 7, 2007. Chief,Executive ... Finance and,Chief Financial Officer, John R. Sluis will ... The webcast, along with accompanying presentation slides, may ...
... Verenium,Corporation (Nasdaq: VRNM ), a leading developer of ... high-performance specialty,enzymes, announced today that Carlos A. Riva, President ... the Cowen and Company Clean,Energy Conference. The presentation is ... 6, 2007 and will take place at Le Parker ...
Cached Biology Technology:Interventional Cardiologists Nico Pijls, Bernard De Bruyne to Discuss Benefits of Measuring Coronary Pressure in Improving Multivessel PCI at ESC Congress 2007 2Cepheid to Present at Thomas Weisel Partners Healthcare Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 3
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: