Webcam MD - Launch of revolutionary web-based medical ... (futureapplications of this technology su...)

(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...

(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...

(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...

(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...

Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2 Bioinformatics Market Worth $7.5 Billion by 2017 2 Bioinformatics Market Worth $7.5 Billion by 2017 3 DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2 North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2 North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3

[0] The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools [0] Bioinformatics Market Worth $7.5 Billion by 2017 [0] DNA Sequencing: Technologies, Markets and Companies - 2013 Report [0] North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017

... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...

... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx. "PrimeraDx,s strategy ... Plex system in the MDx market and define ...

... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...

Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2 PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2 If oxygen becomes the undoing of proteins 2

Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs PrimeraDx Appoints Jeff Liter as VP of Corporate Development If oxygen becomes the undoing of proteins

(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...

(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...

(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...

Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2 Computer modeling technique goes viral at Brandeis 2 The American Society for Microbiology honors Marc Torrent 2

[0] Novel enzyme from tiny gribble could prove a boon for biofuels research [0] Computer modeling technique goes viral at Brandeis [0] The American Society for Microbiology honors Marc Torrent

... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...

... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...

... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...

Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2 Beyond genes: Lipid helps cell wall protein fold into proper shape 3 Tagging pathogens with synthetic DNA 'barcodes' 2 Tagging pathogens with synthetic DNA 'barcodes' 3

Shark skin saves naval industry money Beyond genes: Lipid helps cell wall protein fold into proper shape Tagging pathogens with synthetic DNA 'barcodes'

... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...

Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...

... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...

...

Biology Products:

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation Mouse Anti-Human PRKG1 Monoclonal Antibody, Unconjugated, Clone 5E5 from Abnova Corporation Eppendorf Thermomixer R from Eppendorf North America GeneSnap from SYNGENE