Navigation Links
Victhom announces completion of joint venture agreement with Otto Bock for Neurobionix activities
Date:6/18/2009

QUEBEC, June 18 /PRNewswire-FirstCall/ - Following the announcement on April 30, 2009, of the execution of a partnership agreement between Victhom Human Bionics Inc. ("Victhom", TSX: VHB) and Otto Bock HealthCare GmbH ("Otto Bock"), Victhom announced today the completion of the transaction contemplated by the partnership agreement and the approval by its shareholders and debenture holders of the concurrent restructuring of its outstanding convertible debentures by way of plan of arrangement.

On June 16, 2009, the arrangement resolution was approved by 98% of Victhom's shareholders present or represented by proxy at the annual and special meeting of shareholders, and by 97% of the debenture holders at the debenture holders' meeting held earlier that day.

On June 17, 2009, the Quebec Superior Court issued its final order approving the implementation of the plan of arrangement providing inter alia for the consolidation of Victhom's common shares on a 10 for 1 basis and the conversion the 7% convertible debentures maturing in March 2010 in the capital amount of CAN$ 18,354,000 into a newly created class of preferred shares.

The 10:1 consolidation will take effect as of today but the common shares of the Corporation will transact on a post-consolidation basis on the Toronto Stock Exchange on June 23, 2009. It is expected that share certificates representing the preferred shares and the newly consolidated common shares will be made available to debenture holders and shareholders shortly.

As part of the arrangement and pursuant to the partnership agreement, Victhom has transferred all of the assets and liabilities of its Neurobionix division to the newly created general partnership, "Neurostream Technologies General Partnership" ("Neurostream Technologies"), concurrent with an initial equity investment of CAN$ 12.5 million in Neurostream Technologies by Otto Bock. At closing, Neurostream Technologies is owned 55.6% by Otto Bock and 44
'/>"/>

SOURCE VICTHOM HUMAN BIONICS INC.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Victhom and Otto Bock sign partnership agreement to establish joint venture for Neurobionix activities
2. Victhom announces the filing of a patent application to address sudden unexplained death in epilepsy (SUDEP)
3. Victhom Human Bionics Receives CE Mark for the Neurostep(TM) System, the Worlds First Fully Implantable Closed-Loop Neuromodulation Therapy for Treatment of Foot Drop
4. Victhom Human Bionics Neurobionix Division receives ISO 13485:2003 Certification for its Design Control System
5. Victhom announces the completion of the second phase of the apnea therapy development
6. Victhom Announces Launch of Enhanced Company Website
7. Victhom to Participate in the OneMedPlace Finance Forum
8. Victhom announces promising results on the proof of concept for its unique closed-loop neuromodulation system
9. Environmental Tectonics Corporation Announces Additional Hyperbaric Monoplace Chamber Sale to St. John Wound Center
10. Shamir Optical Industry Ltd. Announces Availability of Its Annual Report on Form 20-F Through Its Website
11. Spectral announces publication demonstrating Toraymyxin(TM) significantly reduces mortality from sepsis in prospective controlled trial
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: