Navigation Links
Varian to Showcase RapidArc(TM) Radiotherapy Technology Enhancements at ASTRO 2008
Date:9/22/2008

ibutions to protect healthy tissues.

"Non-coplanar beams can be particularly useful, for example, when treating brain tumors that lie in the same plane as the eyes," explains Corey Zankowski, senior director for oncology product management. "By rotating the couch during treatment to deliver arcs from different angles, clinicians can greatly minimize any exposure of the eyes and still achieve an excellent dose distribution within the targeted tumor."

Joseph Ting, chief medical physicist at the MIMA Cancer Center in Melbourne, Florida, elaborates: "We'll see a big benefit in treating certain head and neck cancer cases, particularly when the tumor is low in the neck area, so that a conventional arc would pass through the shoulder area. You can reduce the amount of normal tissue exposed to the beam by choosing several arcs that enter away from the shoulder," he said.

According to Ting, use of multiple arcs in different planes also allows doctors to spread out the peripheral dose more widely, so that surrounding normal tissues receive much less radiation. "Normal tissue tolerances for low levels of radiation are pretty well known," Ting said. "By spreading the peripheral dose out over a greater volume of tissue, we can keep the level very, very low in any given area, particularly when treating with high-dose stereotactic radiosurgery."

Using several arcs also makes it possible to treat multiple tumors simultaneously. For example, when two or more tumors in the brain lie in front of one another, they can be accurately targeted with a single treatment that devotes an arc to each.

"This new version of RapidArc is part of our commitment to the continual development of versatile, uncompromising solutions for targeting cancer and minimizing undesirable side effects," says Knott. "With these enhancements, we are providing doctors with more angles of approach to use when targeting diseased tissue, and more degrees of freedom to optimize the tre
'/>"/>

SOURCE Varian Medical Systems, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Six UK Hospitals Join Together in Using Varian Medical Oncology Information Network
2. Varian Medical Systems Exhibits Latest Technologies and Products Designed to Improve Speed and Precision of Radiotherapy at ESTRO 2007
3. Varian Medical Systems Receives FDA 510(k) Clearance for High-Definition Collimator That Enables Ultra-Fine Intensity-Modulated Radiosurgery
4. Bavarian Nordic Receives $50 Million Advance Payment from HHS for Fulfilling Contract Milestones
5. Varian Medical Systems Introduces New and Improved VariSeed(TM) 8.0 Software for Permanent Seed Prostate Brachytherapy Treatments
6. New SPE Cation Exchange Technology From Varian Simplifies Extraction of Basic Compounds
7. Varian Medical Systems Sponsors Special Broadcast of The Group Room(R), a Live Radio Talkshow About Cancer
8. Varian, Inc. Reports First Quarter 2008 Results
9. deCODE Discovers Gene Variants that May Help to Distribute the Work of Evolution between Men and Women
10. AEterna Zentaris Reports First Patients Treated with Anti-Cancer Compound AEZS-108 in Phase 2 Trial in Ovarian and Endometrial Cancers
11. New Chromatography Detectors From Varian, Inc. Extend the Range of Universal Detection for HPLC and LC/MS
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... /PRNewswire-Asia-FirstCall/ -- Genesis,Pharmaceuticals Enterprises, Inc. (OTC Bulletin ... pharmaceutical company with its principal operations in ... it engaged KPMG Huazhen,("KPMG"), a member firm ... firms,affiliated with KPMG International, to assist the ...
... & Company, LLC, a,Boston-based life science investment bank, ... joined the firm as senior advisor. In ... on internal and client-related activities including,merger & acquisition ... focus on biopharmaceutical transactions. "We are delighted ...
... PTNEW YORK, Jan. 13 Keryx Biopharmaceuticals, Inc. (Nasdaq: ... Weiss, the Company,s Chairman and Chief Executive Officer, is ... Healthcare Conference being held in San Francisco.Mr. Weiss, presentation ... 1:00pm PT and will be accessible from the Investor ...
Cached Biology Technology:Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 2Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 3Keryx Biopharmaceuticals to Present at the J.P. Morgan 27th Annual Healthcare Conference 2
(Date:9/23/2014)... Fruit and vegetable consumption could be as good for ... , The research, conducted by the University of Warwick,s ... England, and published by BMJ Open focused ... mental wellbeing were consistently associated with an individual,s fruit ... mental wellbeing ate five or more portions of fruit ...
(Date:9/23/2014)... infant chimpanzees from their mothers are well documented, little ... of early life experience. In a year-long study, scientists ... that those who were removed from their mothers early ... performers are likely to show behavioral and social deficiencies ... in the open-access journal PeerJ , was led ...
(Date:9/22/2014)... GAINESVILLE, Fla. --- Many native species have vanished ... University of Florida scientists have discovered how fossils ... , The key lies in organic materials found ... ancient ecosystems functioned, according to a new study ... the Journal of Herpetology . Pre-human island ...
Breaking Biology News(10 mins):Eating five a day may keep the blues away 2Chimpanzees raised as pets or performers suffer long-term effects on their behavior 2Answer to restoring lost island biodiversity found in fossils 2
... New findings from a landmark clinical trial show that although ... to develop age-related macular degeneration (AMD), a potentially blinding eye ... do not predict how patients will respond to Lucentis and ... "wet" form of AMD. This new data from the Comparison ...
... change to current dosages for sleeping medications in women ... that flu dosages for women be reconsidered as well. ... common practice, but we aren,t there yet. To accelerate ... education and clinical training, the Sex and Gender Women,s ...
... from engineers at Rensselaer Polytechnic Institute and the University of ... powerful new tool for manipulating cells. Results of the study, ... blue light can be used as a switch to prompt ... process of clustering, or oligomerization, is commonly employed by nature ...
Cached Biology News:Major clinical trial finds no link between genetic risk factors and 2 top wet AMD treatments 2Sex and gender competency essential to medical care 2Nature Methods study: Using light to control cell clustering 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: