Navigation Links
Tunisia Hosts First African Summer School on Optics and Applications to Sustainable Development

TUNIS, Tunisia (PRWEB) November 06, 2013

More than 60 graduate and post-doctoral students and 20 speakers from several countries attended the recent first African Summer School on Optics and Applications to Sustainable Development (ASOSD) in Tunis.

Organized by the Optical Society of Tunisia and supported by SPIE, the international society for optics and photonics, the International Commission for Optics (ICO), International Centre for Theoretical Physics (ICTP), the African Laser, Atomic, Molecular and Optical Sciences Network (LAM), the Optical Society (OSA), and several other organizations, the school ran 31 August through 8 September.

The workshop series is being organized by universities throughout Africa to provide education and training for advanced graduate students and post-doctoral faculty in optics, laser science and technology. A second workshop is being planned for 2015.

Students and speakers at this year’s event were from Tunisia, Algeria, Morocco, Egypt, Cameroon, Kenya, Portugal, South Africa, Nigeria, Italy, and France.

Topics included optical communications, optical fibers and lasers; industrial applications and laser material processing; optics and the environment; optics and energy; biophotonics, biomedical applications and optical diagnosis techniques; and theoretical methods and experimental techniques.

Among the speakers, Zohra Ben Lakhdar of Tunis El Manar University gave an overview of ICO activities.

John Dudley of the Université de Franche-Comté spoke on progress “Towards an International Year of Light 2015.” Dudley is president of the European Physical Society and has been heading up the initiative working for United Nations endorsement and launch of an International Year of Light.

Other invited speakers included:

  •     Rim Cherif (assistant professor, Faculty of Sciences, Tunis El Ma

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. U.S.-Russia Innovation Corridor Hosts Biotech & IT Startups
2. Hemostemix Hosts Cell Therapy Industry Seminar
3. Funding Tomorrow's Biomedical Research: California Healthcare Institute Hosts Pipeline for Life, July 15
4. DTx Hosts Webinar on New Intel® Haswell Platform
5. Black Data Processing Associates (BDPA) New Jersey Hosts 10th Annual Families in Technology Day June 8, 2013
6. Industry Leader Linguamatics Hosts Record-breaking Spring Users Conference in Cambridge, UK
7. Cambridge College School of Management Program Hosts a Panel Discussion On Trends and Opportunities In Health Information Technology
8. San Diego State University Hosts Open House for Life Science Immersion Biotechnology Program
9. Ultra Light Startups Hosts Future Energy Investor Feedback Forum at MIT
10. Bayer CropScience Hosts Third Sustainability in Agriculture: A Bayer Executive Course
11. Smith & Nephew hosts thought-leading surgeons, showcases new technology at American Academy of Orthopaedic Surgeons annual meeting
Post Your Comments:
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: