Navigation Links
Tibotec Advances Global Clinical Research Program for TMC435 in HCV; Will Present Four Abstracts Evaluating Safety and Efficacy at EASL
Date:3/29/2011

CORK, Ireland, March 29, 2011 /PRNewswire/ -- Tibotec Pharmaceuticals announced today that four abstracts reporting research findings with TMC435, the company's investigational hepatitis C protease inhibitor, have been accepted for presentation at the 46th Annual Meeting of the European Association for the Study of the Liver (EASL) in Berlin, Germany, March 30 to April 3, 2011.  

The four abstracts for TMC435 support Tibotec's continued efforts to advance its research and development program for the treatment of HCV.  TMC435 highlights at the meeting include one oral presentation and one late-breaker poster presentation:

  • Analysis of the predictive nature of IL28B genotype and pretreatment serum IP-10 in treatment-naive HCV patients from phase IIb PILLAR study on TMC435 administered with pegIFN/ribavirin
  • Results from interim 24 week data of the international phase IIb randomized, double-blind, placebo-controlled ASPIRE study on efficacy, tolerability, safety, and pharmacokinetics of TMC435 administered with pegIFN/ribavirin in treatment-experienced HCV patients

  • "Tibotec is committed to developing innovative new treatment options that may offer better treatment outcomes and that may decrease the duration of treatment for patients with chronic hepatitis C infection," said Brian Woodfall M.D., Vice President of Global Clinical Development at Tibotec. "The company's presence at this year's EASL meeting and the recent launch of the phase 3 clinical trial program for TMC435 reinforce the value of this investigational agent in our growing HCV pipeline."

    The titles of the abstracts and times for Tibotec's presentations on TMC435 appear below – full abstracts can also be accessed at www.easl.eu.

    Oral Presentation:

  • "Impact of IL28B genotype and pretreatment serum IP-10 in treatment-naive genotype-1 HCV patients treated with TMC435 i
    '/>"/>

  • SOURCE Tibotec Pharmaceuticals
    Copyright©2010 PR Newswire.
    All rights reserved

    Page: 1 2 3

    Related biology technology :

    1. According to AlphaDetail, Inc. Merck and Tibotec Therapeutics Lead Among Infectious Disease Specialists
    2. 3-D printing method advances electrically small antenna design
    3. SG Biofuels Advances Jatropha Biotech Platform with Application of Genetic Markers to Reference Genome
    4. Redpoint Advances Salt Enhancer Discovery Program
    5. Circassia Initiates Phase II Trials of Novel Grass and Ragweed Allergy Therapies and Advances Phase III Plans for cat Allergy T-Cell Vaccine
    6. Santaris Pharma A/S Advances miravirsen, the First microRNA-Targeted Drug to Enter Clinical Trials, Into Phase 2 to Treat Patients Infected With Hepatitis C Virus
    7. New treatment for rabies advances after successful phase 1 trial in India
    8. Reportlinker Adds Advances in Biopharmaceutical Technology in China
    9. New Advances in Understanding of Parasite Risk Showcased at CVBD World Forum
    10. MacroGenics Receives NIH Grant Funding of $9.8M for Three Projects; Funding Further Advances DART Platform and Infectious Disease Portfolio
    11. Fulton Project Advances to Phase 2 of Loan Guarantee Process
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
    (Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
    (Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
    (Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
    Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
    ... Created Role of Senior Vice President of ... Philip R. Licari to Step Down as Chief Operating Officer upon Closing ... ... ), the manufacturer of the NxStage System One (TM),portable kidney dialysis machine, today ...
    ... SAN CARLOS, Calif., Aug. 29 Nektar,Therapeutics (Nasdaq: ... Lingnau has been,appointed to serve on its board ... with over 35 years of experience in,corporate management, ... to Nektar extensive pharmaceutical development and,commercialization experience at ...
    ... Colo., Aug. 29 Pharmion Corporation,(Nasdaq: PHRM ... Drug Administration,(FDA) has granted Fast Track designation for ... Fast Track programs are designed to facilitate ... that are intended to treat serious or,life-threatening conditions ...
    Cached Biology Technology:NxStage Medical Provides Update on Medisystems Acquisition 2NxStage Medical Provides Update on Medisystems Acquisition 3NxStage Medical Provides Update on Medisystems Acquisition 4NxStage Medical Provides Update on Medisystems Acquisition 5Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 2Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 2Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 4Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 5Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 6
    (Date:5/7/2015)... Sweden , May 7, 2015 ... touch fingerprint sensors, FPC1022 and FPC1035, FPC,s smallest ... and FPC1035 are mainly considered for integration on ... size gives smartphone OEMs increased possibilities to integrate ... The decreased size also improves possibilities for module ...
    (Date:5/5/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market, reminds investors and media that  Mr. ...  at CARTES SECURE CONNEXIONS AMERICA 2015, held in ... The three-day conference is organized into a series of nine ... Global Fraud: Where is the Trust in Cyberspace? ...
    (Date:4/27/2015)... Apr. 27, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... pre-order customers the first week of May, 2015 and ... of May. Gino Pereira , ... for the company as Wocket® enters the consumer market. ...
    Breaking Biology News(10 mins):FPC Introduces its Smallest Touch Fingerprint Sensors to Date 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 2Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 3
    ... change on the microbial communities of two important ecosystemsthe ... a University of Oklahoma research group has been awarded ... to Jizhong Zhou, OU professor of botany and microbiology ... results of these studies could potentially contribute to the ...
    ... Medical Research in Melbourne, Australia, has entered a ... to evaluate and potentially develop for research and ... The institute has a portfolio of more than ... facility for research into cancer, chronic inflammatory diseases ...
    ... scientists from Singapore led by the Genome Institute of ... Biology (IMCB), two biomedical research institutes of Singapore,s ... the most important genes in human embryonic stem cells ... cells work. Their research, published in top scientific journal ...
    Cached Biology News:Biotech collaboration established to commercialize research reagents 2Singapore scientists first to perform genome-wide study of human stem cells 2
    ...
    ... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
    ... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
    ... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
    Biology Products: