Navigation Links
TechConnect World 2010 Solving Global Technology Challenges with Clean Technology, Nanotechnology and Biotechnology
Date:9/2/2009

a>

About CTSI:

The Clean Technology & Sustainable Industries Organization (CTSI), a 501c6 non-profit industry association, represents the organizations developing, commercializing, and implementing energy, water, and environmental technologies. Clean technologies offer much needed solutions to growing resource security and sustainability concerns and are critical to maintaining economic competitiveness. CTSI brings together global leaders for advocacy, community development, networking, and information sharing to help bring these needed technologies to market more rapidly. Visit www.ct-si.org for more information.

About NSTI:

The Nano Science and Technology Institute (NSTI; www.NSTI.org) advances and integrates nano and other advanced technologies through education, conventions, business publishing, and research services. NSTI produces the annual TechConnect World conference and trade show, which attracts more than 5,000 industrial, academic, business and governmental attendees from around the word. It is the largest gathering of the nanotechnology industry in the U.S. NSTI was founded in 1997 as a result of the merger between various scientific societies, and is headquartered in Cambridge, Massachusetts with offices in California and Switzerland.

    Contact Information:
    Christopher Erb
    1 (978) 561-1908
    cerb@techconnect.org


'/>"/>
SOURCE NSTI
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Dozens of New Clean Technology and Nanotech Products Unveiled at TechConnect World Expo in Houston, Texas, May 5-6
2. TechConnect World Conference Showcases Houston Leaders May 3-7, at the George R. Brown Convention Center
3. TechConnect Summit Brings the Global Technology Community to Houston, May 4-6, 2009
4. TechConnect World Announces The CancerNano 2009 Symposium May 3-7, at the George R. Brown Convention Center in Houston
5. TechConnect World Publishes Conference Agenda Featuring More than 2,700 Presentations Addressing Nano, Bio and Clean Technologies
6. TechConnect World 2009 Announces January 28th Last Call for Speaker-Proposals
7. TechConnect World 2009 Matches Tomorrows Technology Solutions with Todays Business Needs for Clean-Technology, Biotechnology and Nanotechnology
8. avVaa World Health Care Products, Inc. Announces the completion of its first week of DRTV 120/60 second test commercials for Neuroskin(R) Psoriasis Relief
9. Stemedica Selected By World Stem Cell Summit To Present Scientific Discoveries
10. NeoStem CEO to Participate in 2009 World Stem Cell Summit on September 23rd
11. American Scientific Resources To Be Exclusive Seller of Worlds Only FDA Approved Home Needle Destruction Device
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
(Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
(Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
(Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
... Created Role of Senior Vice President of ... Philip R. Licari to Step Down as Chief Operating Officer upon Closing ... ... ), the manufacturer of the NxStage System One (TM),portable kidney dialysis machine, today ...
... SAN CARLOS, Calif., Aug. 29 Nektar,Therapeutics (Nasdaq: ... Lingnau has been,appointed to serve on its board ... with over 35 years of experience in,corporate management, ... to Nektar extensive pharmaceutical development and,commercialization experience at ...
... Colo., Aug. 29 Pharmion Corporation,(Nasdaq: PHRM ... Drug Administration,(FDA) has granted Fast Track designation for ... Fast Track programs are designed to facilitate ... that are intended to treat serious or,life-threatening conditions ...
Cached Biology Technology:NxStage Medical Provides Update on Medisystems Acquisition 2NxStage Medical Provides Update on Medisystems Acquisition 3NxStage Medical Provides Update on Medisystems Acquisition 4NxStage Medical Provides Update on Medisystems Acquisition 5Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 2Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 2Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 4Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 5Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 6
(Date:5/7/2015)... Sweden , May 7, 2015 ... touch fingerprint sensors, FPC1022 and FPC1035, FPC,s smallest ... and FPC1035 are mainly considered for integration on ... size gives smartphone OEMs increased possibilities to integrate ... The decreased size also improves possibilities for module ...
(Date:5/5/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market, reminds investors and media that  Mr. ...  at CARTES SECURE CONNEXIONS AMERICA 2015, held in ... The three-day conference is organized into a series of nine ... Global Fraud: Where is the Trust in Cyberspace? ...
(Date:4/27/2015)... Apr. 27, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... pre-order customers the first week of May, 2015 and ... of May. Gino Pereira , ... for the company as Wocket® enters the consumer market. ...
Breaking Biology News(10 mins):FPC Introduces its Smallest Touch Fingerprint Sensors to Date 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 2Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 3
... change on the microbial communities of two important ecosystemsthe ... a University of Oklahoma research group has been awarded ... to Jizhong Zhou, OU professor of botany and microbiology ... results of these studies could potentially contribute to the ...
... Medical Research in Melbourne, Australia, has entered a ... to evaluate and potentially develop for research and ... The institute has a portfolio of more than ... facility for research into cancer, chronic inflammatory diseases ...
... scientists from Singapore led by the Genome Institute of ... Biology (IMCB), two biomedical research institutes of Singapore,s ... the most important genes in human embryonic stem cells ... cells work. Their research, published in top scientific journal ...
Cached Biology News:Biotech collaboration established to commercialize research reagents 2Singapore scientists first to perform genome-wide study of human stem cells 2
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: