Navigation Links
Synthetic Genomics Inc. and Plenus, S.A. de C.V. Form New Sustainable Agriculture Company, Agradis, Inc. to Develop and Commercialize Products Using Genomic Technologies
Date:10/24/2011

genetic enhancement, and in producing microbe-based plant enhancers for the wheat and corn markets. Agradis currently has field research stations in the United States and Mexico. For more information please visit www.agradis.com

About Synthetic Genomics Inc.

SGI, a privately held company founded in 2005, is dedicated to developing and commercializing genomic-driven solutions to address global energy and environment challenges. Advances in synthetic genomics present limitless applications in a variety of product areas, including: energy, chemicals and pharmaceuticals. The company's main research and business programs are currently focused on the following major bioenergy areas: designing advanced biofuels with superior properties compared to ethanol and biodiesel; harnessing photosynthetic organisms to produce value added products directly from sunlight and carbon dioxide; developing new biological solutions to increase production and/or recovery rates of subsurface hydrocarbons and developing high-yielding, more disease resistant and economic feedstocks. For more information go to www.syntheticgenomics.com

About Plenus, S.A. de C.V.  

Plenus is a Mexico based investing and management private company. Its management team has been together for over two decades successfully creating significant value in several industries and investing in companies globally. Plenus participates in the agribusiness, real estate, infrastructure/construction, education, financial services, and new business development industries. This experience includes founding Seminis in 1994 and building it to the world leader and major consolidator in the fruit and vegetable seed business. Nearly ten years ago, Plenus embarked on a strategic initiative to participate in the international biofuel industry by creating genetically improved biofuel feedstock crops that do n
'/>"/>

SOURCE Synthetic Genomics Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Swedish University Hospital Improves Monitoring of Treatment Efficacy in Multiple Sclerosis With Synthetic MRI Innovation
2. Kuros Announces Allowance of European Patent for Synthetic Biomaterials
3. Synthetic Genomics Inc. Appoints Joseph Mahler as Chief Financial Officer
4. Life Technologies Signs Exclusive License Agreement for TAL Effector Technology That Enables Synthetic Biologists to Precisely Control Gene Expression in Engineered Organisms
5. Open-source software designed to minimize synthetic biology risks
6. For testing skin cream, synthetic skin may be as good as the real thing
7. iGEM team helps prevent rogue use of synthetic biology
8. Reportlinker Adds Global Synthetic Biology Industry
9. Seeing the world with new eyes: Biosynthetic corneas restore vision in humans
10. Biosynthetic corneas formulated with recombinant collagen restore vision and nerve growth
11. iGEM team helps prevent rogue use of synthetic biology
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... San Diego, CA (PRWEB) December 18, 2014 ... announces a limited time special on Sartorius Biohit ... 1 Free on mLINE pipettes, Picus Electronic Pipette Trade-in ... recommended by Health and Safety officers around the world. ... repetitive manual pipetting. Other features include:, , ...
(Date:12/19/2014)... 18, 2014   ISN has released its ... Indicators publication series. With data aggregated from ... in 2013 within its online contractor management platform, ISNetworld, ... performance indicator (KPI) statistics. The ... publication is available in two industry specific volumes: ...
(Date:12/17/2014)... Based on the revenues gained ... market is dominated by four major players contributing ... These players include GE Healthcare (U.K.), Siemens AG ... , Full Report Copy at http://www.marketsandmarkets.com/Market-Reports/surgical-imaging-market-210534462.html ... be attributed to its strong product portfolio, which ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
Breaking Biology Technology:Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8
... 2011 Verenium Corporation (Nasdaq: VRNM ), ... industrial enzyme solutions, today announced that James Levine, Executive ... the upcoming Piper Jaffray Sixth Annual Clean Technology & ... 3:00 p.m. EST on Wednesday, January 12, 2011 and ...
... , WEST LAFAYETTE, Ind. - Researchers are creating a ... natural photosynthetic systems in plants by using carbon nanotubes ... and reducing cost. "We,ve created artificial photosystems using ... to electrical power," said Jong Hyun Choi, an assistant ...
... and BUDAPEST, Hungary, Jan. 4, 2011 The IP ... property research and analysis solutions, and ChemAxon, the leader ... announced a strategic partnership whereby Thomson Reuters is providing ... patent data to users of ChemAxon,s JChem chemical software ...
Cached Biology Technology:Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 2Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 3New solar cell self-repairs like natural plant systems 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 3
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... a soil science professor at the University of Guam, has ... use in shielding the reefs in Pago Bay from the ... major health hazards facing Guam,s reefs is soil erosion resulting ... up a reef system. "Vetiver,s ability to tolerate high stress ...
... fog, tennis shoes, chocolate mousse, and proteins have something in ... of research that explains the behavior of a wide variety ... and a number of biological materials. In the ... made of (Springer), Roberto Piazza, professor of condensed matter physics, ...
... in their personal and professional lives, University of ... gain greater control over their thoughts with real-time ... first investigation of how real-time functional Magnetic Resonance ... for higher-order thoughts, including introspection, affects our ability ...
Cached Biology News:Bioengineering with vetiver grass on Guam 2Soft matter -- the stuff that dreams are made of 2People control thoughts better when they see their brain activity: UBC study 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: