Navigation Links
Syngenta and The Royal Society of Chemistry Launch African Science Initiative
Date:11/21/2007

:

"The RSC is delighted that Syngenta has embraced so enthusiastically and generously our vision for the Pan Africa Chemistry Network that will help build the chemical science capacity that is vital for social and economic development across the Continent. We are looking forward to partnering with Syngenta and our African colleagues to build a network of local and national chemical science communities that will address such fundamental challenges as food security, disease control and biodiversity.

"With Syngenta's support, the Pan Africa Chemistry Network will bring African scientists together to address these key issues through new initiatives spanning education and research, workshops, exchange programs and increased knowledge sharing. Syngenta's partnership will have a significant impact on chemical scientists in Africa as they strive to translate Millennium goals into reality across this vast Continent."

RSC chief executive Dr Richard Pike said: "Built upon the success of the RSC Archives for Africa which was launched in Ethiopia last year and thanks in large part to the grant from Syngenta, the Pan Africa Chemistry Network is an innovative approach to develop science education in Africa."

The Royal Society of Chemistry is the UK Professional Body for chemical scientists and an international Learned Society for the chemical sciences with some 43,000 members worldwide. It is a major international publisher of chemical information, supports the teaching of chemical sciences at all levels and is a leader in bringing science to the public.

Syngenta is a world-leading agribusiness committed to sustainable agriculture through innovative research and technology. The company is a leader in crop protection, and ranks third in the high-value commercial seeds market. Sales in 2006 were approximately $8.1 billion. Syngenta employs around 21,000 people in over 90 countries. Syngenta is listed on the Swiss stock exchange (SYNN) and in New Yo
'/>"/>

SOURCE Syngenta
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Syngenta Licenses Chromatin Gene Stacking Technology
2. Drug Royalty Corporation (DRC) Announces Acquisition Regarding PEG-INTRON(R) From Enzon Pharmaceuticals, Inc. (ENZN)
3. Argonne scientist to give the plenary talk at Royal Society of Chemistry meeting on nanoalloys
4. Drug Royalty Corporation Changes Its Name to DRI Capital
5. Cowen Group, Inc. and Cowen Healthcare Royalty Partners Announce Expansion of Royalty Investment Team
6. Beaumont Hospital, Royal Oak Treats Its First Patients With Elekta Axesse
7. Vicus Therapeutics to Present at the 234th American Chemical Society National Meeting in Boston, MA
8. Three Studies by Independent Scientists Highlighting Pressure Cycling Technology (PCT) to be Presented this Week at the British Mass Spectrometry Societys 29th Annual Meeting
9. Society of Laproendoscopic Surgeons Names Starion Instruments 2007 Innovator of the Year
10. Diageo Sponsors Medical Society of the State of New Yorks Physicians Training Program
11. Cheetah Medicals NICOM Non-Invasive Cardiac Output Monitor Featured in a Presentation at the Heart Failure Society of America (HFSA) Annual Meeting
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , http://www.videonewswire.com/event.asp?id=80894 How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: