Navigation Links
Symbiotic microbes induce profound genetic changes in their hosts
Date:7/28/2008

antage of a relatively simple host-bacterium relationship: the Hawaiian bobtail squid, a colorful critter less than two inches long that nurtures a single type of light-producing bacteria, called Vibrio fischeri. The bacteria take up residence in a specialized pouch on the squid's belly and produce light that the squid uses as anti-predator camouflage. In return, the bacteria receive easy access to nutrients from the squid.

In the new study, a team led by former UW-Madison graduate student Carlene Chun dissected the genetics of the squid host response, including a comparison with mutant bacteria unable to successfully colonize their host. They identified hundreds of genes affected by the establishment of a stable bacterial partnership, including some known to play a role in human responses to bacteria.

The involvement of several genes typically associated with responses to bacterial infection, such as members of common immune signaling pathways, suggests we may need to rethink our understanding of the main purpose of the immune system, McFall-Ngai says.

"We have thousands of bacteria that live with us, and yet there are only around 100 bacterial pathogens," she says. Given the numbers, "it seems like these pathways and these molecules are likely to be 'symbiosis' pathways more than 'anti-pathogen.'"

Her team also highlighted several genes corresponding to those previously implicated in establishing symbiotic relationships with gut bacteria in fish and mice, suggesting that the animal-bacteria conversation may be basically the same across evolution.

"All animals and plants evolved in the background of the presence of huge numbers of environmental bacteria These genes might be considered the core conserved responses of animals to interactions with bacteria" along tissue surfaces like intestine walls and skin, McFall-Ngai says. "The language is ancient and highly conserved."


'/>"/>

Contact: Margaret McFall-Ngai
mjmcfallngai@wisc.edu
608-262-2393
University of Wisconsin-Madison
Source:Eurekalert

Page: 1 2

Related biology technology :

1. New Phase III Data Demonstrate Oxycodone / Naloxone Combination Tablet Reduces Opioid-Induced Bowel Dysfunction in Patients With Chronic Severe Pain
2. Entry of Biogenerics and Decreasing Use of Amgens Epogen and Johnson & Johnsons Procrit Will Cause a $2.8 Billion Decline in the Drug Market for Chemotherapy-Induced Anemia by 2016
3. ProMetic reports continued positive data in PBI-1402 phase II trial in chemotherapy-induced anemia
4. New Therapy by Merck is Positioned to Earn Gold-Standard Status by 2011 in the Treatment of Chemotherapy-Induced Nausea and Vomiting
5. Oral PBI-1402 Demonstrates Significant Activity in Chemotherapy-Induced Anemia Phase II Clinical Trial
6. Wyeth and Progenics Receive Positive Opinion From European Committee for RELISTOR for the Treatment of Opioid-Induced Constipation in Advanced-Illness Patients
7. Two Year Study Confirms SUPPRELIN(R) LA Implant Maintains Profound Suppression of Hormones in Children With Premature Onset Puberty
8. Digital Unions RT1(TM) Software Creates Telegenetics Network for Region 3 Genetics Collaborative
9. Response Genetics Reports Second Quarter 2007 Financial Results
10. ZymoGenetics Will Hold Conference Call Today at 5:00 p.m. Eastern Time to Provide Update on rThrombin
11. Clinical Data Acquires Epidauros Biotechnologie AG, Significantly Enhancing Proprietary Genetic Biomarker Portfolio
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... FRANCISCO, Calif., Oct. 3 Cell,Genesys, Inc. (Nasdaq: ... officer of Cell Genesys, will present a company update ... BIO Investor Forum being,held in San Francisco, California. ... accessible through the,Investor Relations section of the Cell Genesys ...
... Grant Funding to Advance the Development of Single-Stranded ... ... (Nasdaq: ISIS ) today announced that it has been,awarded a ... Institutes of Health (NIH) for up to $1.5 million to,design oligonucleotide ...
... Than Doubles Assets Under Management, UTRECHT, The Netherlands, ... venture capital firm, today announced,the closing of its EUR ... (GHC II). The new fund, which is Gilde,s second ... to invest in European,healthcare opportunities. GHC II was backed ...
Cached Biology Technology:Cell Genesys to Present at the BIO Investor Forum 2Isis Awarded $1.5 Million NIH Grant to Improve Chemical Properties of RNAi-Based Therapeutics 2Isis Awarded $1.5 Million NIH Grant to Improve Chemical Properties of RNAi-Based Therapeutics 3Gilde Healthcare Partners Closes EUR 150 Million European Healthcare Venture Fund 2
(Date:6/15/2015)... Jun. 15, 2015 NXT-ID, Inc. (NASDAQ: NXTD ) ... the growing mobile commerce market, announces that its leading payment ... media at Digital Experience! @ NYC June 18th. ... the latest innovation in technology to over 300 of the ... at the Metropolitan Pavilion in New York City ...
(Date:6/11/2015)... Daon, a global leader in mobile ... Mobile Authentication Platform v4.0 has been FIDO Certified™.  ... industry consortium launched in 2013 to revolutionize online ... In order to receive certification, a company,s products ... tests that measure compliance and ensure interoperability among ...
(Date:6/9/2015)... , June 9, 2015   MedNet Solutions ... the entire spectrum of clinical research, will be providing ... technology platform at the 2015 Drug Information Association (DIA) ... on June 15-17.  These presentations will include previews of ... out in the upcoming iMedNet 2015 Feature ...
Breaking Biology News(10 mins):Wocket Smart Wallet Exhibiting at Pepcom Digital Experience! @ NYC June 18th 2Wocket Smart Wallet Exhibiting at Pepcom Digital Experience! @ NYC June 18th 3Daon's IdentityX Mobile Authentication Platform One of First Products to be Certified by FIDO Alliance 2MedNet To Provide Sneak Peeks Of Its iMedNet "2015 Feature 1 Release" At The DIA Annual Meeting 2MedNet To Provide Sneak Peeks Of Its iMedNet "2015 Feature 1 Release" At The DIA Annual Meeting 3
... of cell and developmental biology, has been awarded one ... Awards, one of the NIH,s most prestigious grants. ... address a significant medical science challenge: identifying the full ... and disease processes such as cancer. Major, a ...
... professors have been named 2010 fellows of the American ... and Interdisciplinary Studies (CBIS) and the Howard P. Isermann ... and Professor Emeritus of Chemistry Leonard Interrante were both ... and contributions to the science, the profession, and service ...
... parts of the world have brought into sharp focus new ... of rivers during periods of high flow. Using an ... how the flow of river water affects the movement of ... changes in the bed of an artificial water channel to ...
Cached Biology News:UNC scientist receives NIH director's New Innovator Award 2Rensselaer professors Dordick and Interrante named ACS Fellows 2What lies beneath: Study examines sediment movement during floods in rivers 2What lies beneath: Study examines sediment movement during floods in rivers 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: