Navigation Links
Superior Patient Clinical Outcomes Confirms DaVita's Leadership Position on Quality Dialysis Care
Date:7/7/2008

bout DaVita Inc.

DaVita Inc., a FORTUNE 500(R) company, is a leading provider of kidney care in the United States, providing dialysis services and education for patients with chronic kidney failure and end stage renal disease. DaVita manages more than 1,300 outpatient facilities and acute units in more than 700 hospitals located in 43 states and the District of Columbia, serving approximately 107,000 patients. As part of DaVita's commitment to building a healthy, caring community, DaVita develops, participates in and donates to numerous programs dedicated to transforming communities and creating positive, sustainable change for children, families and our environment.

For more information about DaVita, its kidney education and its community programs, please visit http://www.davita.com.

Reference List

a. Tentori F, Hunt WC, Rohrscheib M, Zhu M, Stidley CA, Servilla K,

Miskulin D, Meyer KDB, Bedrick EJ, Johnson HK, Zager PG. Which Targets

in Clinical Practice Guidelines Are Associated with Improved Survival

in a Large Dialysis Organization?, 1998 to 2004. J Am Soc Nephrol 18:

2377-2384, 2007. doi: 10.1681/ASN.2006111250.

b. Wolfe RA, Hulbert-Shearon TE, Ashby VB, Mahadevan S, Port FK.

Improvements in dialysis patient mortality are associated with

improvements in urea reduction ratio and hematocrit, 1999 to 2002. Am J

Kidney Dis 2005; 45(1):127-135.

c. Duong, Uyen, Kalantar-Zadeh K, Kovesdy,C, Mehrotra, R. Mortality Trend

of Hemodialysis Chains in the USA: 1996-2004. National Kidney

Foundation Spring Clinical Meeting 2008.


'/>"/>
SOURCE DaVita Inc.
Copyright©2008 PR Newswire.
All rights reserved

1

GOOD

Page: 1 2 3

Related biology technology :

1. Increasing Sales Productivity Through Superior Sales Force Performance Management
2. By adding graphene, researchers create superior polymer
3. Flurizans Effect in Delaying Progression From Mild Cognitive Impairment to Alzheimers Disease is Superior to That of Aricept
4. Phosphagenics Reports Superior Pre-clinical Cholesterol Results from APA-01 and Atorvastatin Combination
5. Study Reaffirms Superiority of Trofile(TM) Assay
6. Lorus Therapeutics Announces Publication of a Clinical Study Demonstrating Encouraging Results with LOR-2040 in Combination with Cytarabine in Patients with Acute Myeloid Leukemia (AML)
7. Number of Patients Treated with an Antibiotic for MRSA Within U.S. Acute Care Hospitals Increased 8 Percent from 2006 to 2007
8. New Aptivus(R) (tipranavir) Oral Solution Approved for Treatment-Experienced Pediatric and Adolescent HIV Patients
9. TCN e-Systems Offers Trial Sponsors Solutions for Creating In-House Center of Excellence in Patient Recruitment
10. Derma Sciences MEDIHONEY(TM) Helps to Save Patients Limb
11. A Perfect Storm Threatens Patient Access to Specialty Medical Care
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/3/2009)... N.Y., Dec. 3 Nikon Corporation, an innovator ... has signed a licensing agreement with Harvard University ... Optical Reconstruction Microscopy (STORM) technology. Under the terms ... microscopy systems and market them with the N-STORM ...
(Date:12/3/2009)... SHP, Nasdaq: SHPGY ), the global specialty biopharmaceutical ... and voluntary market withdrawal of one lot of the ... taking this action because some Daytrana patches do not ... release liner removal specification, and as a result, patients ...
(Date:12/3/2009)... Dec. 3 Caliper Life Sciences, Inc. (Nasdaq: ... for drug discovery and life sciences research, today introduced ... systems. Living Image software drives the more than 800 ... Image 4.0 features advanced spectral unmixing tools to enhance ...
(Date:12/2/2009)... Dec. 2 Spectrum Blue Steel is emerging as one ... Through the efforts of True Green Energy Group and True ... been in the recycling business for over 25 years, stated ... and is setting the stage for spectacular earnings because of ...
Breaking Biology Technology:Nikon Corporation Acquires License From Harvard University For 'STORM' Super Resolution Microscopy -- Will Create Innovative New 'N-STORM' Microscope 2Nikon Corporation Acquires License From Harvard University For 'STORM' Super Resolution Microscopy -- Will Create Innovative New 'N-STORM' Microscope 3Non-safety-related voluntary recall of a limited portion of Daytrana(R) (methylphenidate transdermal system) patches announced 2Non-safety-related voluntary recall of a limited portion of Daytrana(R) (methylphenidate transdermal system) patches announced 3Non-safety-related voluntary recall of a limited portion of Daytrana(R) (methylphenidate transdermal system) patches announced 4Non-safety-related voluntary recall of a limited portion of Daytrana(R) (methylphenidate transdermal system) patches announced 5Caliper Life Sciences Launches Living Image(R) 4.0 Software 2Spectrum Blue Steel partners with Famous Chemists for Procuring Profitable Applications from Garbage Using the Biosphere MKV and Electrostatic Precipitators 2Spectrum Blue Steel partners with Famous Chemists for Procuring Profitable Applications from Garbage Using the Biosphere MKV and Electrostatic Precipitators 3
... Net Results Improve for Year on Higher Services ... Digirad Corporation,(Nasdaq: DRAD ), a leading ... physicians, offices, hospitals and imaging centers, today,reported narrower ... 2007, on,higher annual revenues and lower operating expenses ...
... DIEGO, Feb. 7 ADVENTRX Pharmaceuticals,Inc. (Amex: ... pharmacokinetic data from,the Company,s marketing-enabling bioequivalence clinical ... for presentation at the 2008,American Association for ... April 12 - 16, 2008 in San ...
... Neal Skipper and Franco Cacialli, of the London ... Physics & Astronomy, University College London (UCL), have ... help them develop alternative fuel supplies for transport ... grant, with funding from the Wolfson Foundation under ...
Other Biology Technology:Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 2Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 3Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 4Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 5Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 6Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 7ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 2ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 3New funding to charge energy research at UCL and the London Centre for Nanotechnology 2
(Date:12/3/2009)... undergo a personality change in warmer water, according to an ... species more aggressive. , Experiments with two species of young ... first time that some reef fish are either consistently timid, ... more marked as water temperatures rise. , A slight lift ...
(Date:12/3/2009)... included in the design of the upcoming forest deal at ... a scientist at the University of Leeds. , Writing ... at least 50% of the carbon credit payments to be ... and Degredation), should be made to forest dwellers directly, and ...
(Date:12/3/2009)... comes to investment in energy efficient technologies research, but ... Dave Delpy believes that more is needed: "Scientific and ... wind and solar power solutions, but more investment is ... we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Firm Says Low Cost Genome Sequencing Is Possible 60782 1Mom was right 3A Nice guys dont always finish last 60778 1Mom was right 3A Nice guys dont always finish last 60778 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 1DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 3
... CA--Version 2.4 of the Integrated Microbial Genomes (IMG) data ... for microbial genome data analysis, has now been released. ... Institute (DOE JGI), IMG has built a popular following ... offered in Spring 2008, now full. DOE JGI has ...
... various plants, animals and microorganisms, Systems Biology is regarded ... research. Current technologies allow biologists to spell all the ... little in the way of deciphering this complex code. ... give them new tools for use in drug discovery ...
... the new in vitro tests, called the Standard Scrapie ... accurate and extremely rapid way, producing results in less ... Panel Assay, allows researchers to quickly distinguish between several ... assays, the scientists were able to show that four ...
Other Biology News:World class in Systems Biology is the aim 2World class in Systems Biology is the aim 3World class in Systems Biology is the aim 4Scripps scientists develop new tests that identify lethal prion strains quickly and accurately 2
... & SSM4, Small space saving design - ideal ... of two models: , - 3D gyratory action ... , Digital speed control and built-in timer , Optional ... rockers are ideal where gentle mixing is required, either ...
...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Biology Products: