Navigation Links
Stem Cell Pioneer Recognized for 20 Years of Discovery and Innovation
Date:11/20/2012

TUCSON, Ariz., Nov. 20, 2012 /PRNewswire/ -- Dr. David Harris, Professor of Immunology at the University of Arizona and a scientific pioneer in the field of stem cell banking, was the recipient of the Arizona BioIndustry Association™ (AZBIO) 2012 award for "20 Years of Discovery and Innovation". The annual AZBIO Awards is Arizona's premier bioscience event and was held at the Phoenix Convention Center.

Dr. Harris is a graduate of Wake Forest University, the leading center for stem cell regenerative medicine and tissue engineering in the world today.

In 1991, Dr. Harris became the first person to bank stem cells for future use.  He did so by banking his first child's cord blood stem cells. In 1992, Dr. Harris founded the Arizona Cord Blood Bank which later evolved to become the Cord Blood Registry™ [CBR], the largest cord blood stem cell bank in the world. Dr. Harris continues as Chief Science Officer at CBR.

In 2011, Dr. Harris founded AdiCyte™, an adult stem cell banking company preserving adipose-derived [mesenchymal] stem cells for future use in regenerative medicine and tissue engineering. Adipose tissue, the medical name for 'fat', is the richest source of mesenchymal stem cells in the human body.

"I believe adipose stem cells have enormous potential in regenerative medicine and healing" Harris said. "My vision is to enable people to bank their stem cells for later use in treatments. Adipose stem cells can differentiate into other tissues such as heart muscle, bone, cartilage, nerve and more. Already, doctors have had success in restoring function after a heart attack, and engineering new organs such as a bladder, trachea or new blood vessels using a patient's own stem cells."

The Arizona BioIndustry Association is comprised of member organizations in business, research, government, and other professions involved in biosciences. AZBio supports the members of the Arizona bioscience community by provid
'/>"/>

SOURCE AdiCyte
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Space Research Institute Honors Senator Hutchison with Pioneer Award
2. Imaging Contract-Research Pioneer, Donald P. Rosen, MD, Named CEO of ACR Image Metrix™
3. Air Force Office of Scientific Research hosts nanotechnology pioneer
4. Dr. Michael Yaremchuk, Leading Performer of Custom-Designed Facial Implants, Pioneers Bespoke Plastic Surgery
5. Glencoe Software and The Journal of Cell Biology Pioneer Publishing of Massive, Ultra-Resolution Images
6. Researchers pioneer worlds first HIV/AIDS nanomedicines
7. Genomatica, Inc., Award-Winning Industrial Biotechnology Pioneer, Selects Alexandria Real Estate Equities, Inc. for Long-Term, Mission-Critical R&D Facility and Corporate Headquarters
8. Metabolex Gout Program Recognized in Windhovers Top 10 Most Interesting Projects to Watch
9. Celebrating 65 Years of Providing Superior Healthcare Products, Mission Pharmacal Continues to Thrive
10. Machine Preservation Significantly Improves Kidney Transplant Survival Over 3 Years Compared to Traditional box of ice
11. Expanded Findings for FirstMarks Completed Clinical Study for Predicting Near-Term (2-3 Years) MI
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: