Navigation Links
Springer to publish new open access journal with the Korean Society for Micro and Nano Systems
Date:11/8/2012

Beginning in March 2013, Springer and the Korean Society for Micro and Nano Systems will partner to publish a new interdisciplinary journal Micro and Nano Systems Letters (MNSL). As a fully sponsored open access journal, it will be part of the SpringerOpen portfolio, available on link.springer.com.

Published quarterly, Micro and Nano Systems Letters is an international journal covering research and development in the field of micro- and nano-scaled devices, systems, and manufacturing technologies. The journal will publish current research from around the world. The articles will report on new and significant findings that represent recent advances and practical applications of micro and nano systems engineering and technology.

MNSL offers express online publication of short research papers containing the latest advances in micro- and nano-scaled devices and systems. It also offers a rapid route for the international dissemination of high-quality research findings from both the micro and nano communities.

"It is our great pleasure to work with Springer in the publication of MNSL. With the growing interest in micro- and nano-scaled devices, systems, and manufacturing technologies, we firmly believe that MNSL will become one of world's leading journals in the field. As an open access journal, it will quickly gain attention, serving related academic communities as well as industry," said Editor-in-Chief Professor Sang Sik Yang from Ajou University, Suwon, South Korea.

Mark de Jongh, Senior Publishing Editor and coordinator of the Springer publishing program in Korea, said, "We are very enthusiastic about co-publishing this new open access journal. International research in the fields of micro and nano systems has been growing and South Korea is seen as one of the leaders in cutting-edge developments. The journal will be a valuable addition to Springer's impre
'/>"/>

Contact: Renate Bayaz
renate.bayaz@springer.com
49-622-148-78531
Springer
Source:Eurekalert

Page: 1 2

Related biology technology :

1. Thomas Elsaesser and Horst Weller receive the Julius Springer Prize for Applied Physics 2012
2. Recently Published Economic Analysis Highlights the Financial Impact of Attention-Deficit/Hyperactivity Disorder (ADHD) in the United States (US)
3. Seaside publishes research supporting disease-modifying potential of STX209 for fragile X syndrome
4. First Evidence that Adipose Stem Cell-Based Critical Limb Ischemia Treatment is Safe & Effective is published in Circulation Journal by Lead Investigator Dr. Han Cheol Lee of Pusan National University
5. Society of Biological Psychiatry and Elsevier Renew Publishing Agreement
6. Glencoe Software and The Journal of Cell Biology Pioneer Publishing of Massive, Ultra-Resolution Images
7. Published Findings In Human Gene Therapy Methods Journal Demonstrate Cardiums New Catheter-Based Method Significantly Boosts Gene Delivery To The Heart
8. Receptos Co-Publishes Highest Resolution G-Protein Coupled Receptor Structure to Date in Science
9. Spiral Flow(TM) Grafts Enhance Patient Outcomes - New Paper Published in the Prestigious Annals of Vascular Surgery
10. World Biotech API Market Potential Examined in New Topical Study Now Available at MarketPublishers.com
11. Edarbyclor (azilsartan medoxomil and chlorthalidone) Head-to-Head Data Published in Hypertension
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: