Navigation Links
Solar cell directly splits water for hydrogen
Date:2/17/2008

Plants trees and algae do it. Even some bacteria and moss do it, but scientists have had a difficult time developing methods to turn sunlight into useful fuel. Now, Penn State researchers have a proof-of-concept device that can split water and produce recoverable hydrogen.

"This is a proof-of-concept system that is very inefficient. But ultimately, catalytic systems with 10 to 15 percent solar conversion efficiency might be achievable," says Thomas E. Mallouk, the DuPont Professor of Materials Chemistry and Physics. "If this could be realized, water photolysis would provide a clean source of hydrogen fuel from water and sunlight."

Although solar cells can now produce electricity from visible light at efficiencies of greater than 10 percent, solar hydrogen cells like those developed by Craig Grimes, professor of electrical engineering at Penn State have been limited by the poor spectral response of the semiconductors used. In principle, molecular light absorbers can use more of the visible spectrum in a process that is mimetic of natural photosynthesis. Photosynthesis uses chlorophyll and other dye molecules to absorb visible light.

So far, experiments with natural and synthetic dye molecules have produced either hydrogen or oxygen-using chemicals consumed in the process, but have not yet created an ongoing, continuous process. Those processes also generally would cost more than splitting water with electricity. One reason for the difficulty is that once produced, hydrogen and oxygen easily recombine. The catalysts that have been used to study the oxygen and hydrogen half-reactions are also good catalysts for the recombination reaction.

Mallouk and W. Justin Youngblood, postdoctoral fellow in chemistry, together with collaborators at Arizona State University, developed a catalyst system that, combined with a dye, can mimic the electron transfer and water oxidation processes that occur in plants during photosynthesis. They reported the resu
'/>"/>

Contact: Andrea Elyse Messer
aem1@psu.edu
814-865-9481
Penn State
Source:Eurekalert

Page: 1 2 3

Related biology technology :

1. China Technology Announces Entry to the Solar Energy Sector
2. Nanotech could make solar energy as easy and cheap as growing grass
3. Solar cells of the future
4. New nanostructured thin film shows promise for efficient solar energy conversion
5. Solar energy technology licensed
6. Energy Conversion Devices and United Solar Ovonic Enter Into New $55 Million Secured Credit Facility Agreements
7. Discover Testing Settles the Drinking Water Debate: Tap vs. Bottled
8. AspenBio Pharma to Present the Edgewater Research Investor Conference
9. Soap and Water May not be Enough to Fight MRSA Superbug
10. ORNL super water repellent could cause big wave in market
11. RG Global Corporate Update: First Coal Bed Methane Water Treatment Plant Near Completion; Expanding Water Treatment Applications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... (PRWEB) December 19, 2014 The ... to the rising ageing population and technological innovations ... and nutraceutical industries are catalysing the growth of ... @ http://www.marketsandmarkets.com/Market-Reports/empty-capsules-market-218018190.html , Scope of Report ... as well as new entrants/smaller firms to gauge ...
(Date:12/19/2014)... 18, 2014 Relmada Therapeutics, Inc. (OTCQB: RLMD), ... of chronic pain, announced the results of its annual ... was a transformational year in Relmada,s history and it ... company," said Sergio Traversa , chief executive officer ... on key financial, human resource and clinical development objectives ...
(Date:12/17/2014)... RIDGE, N.J. (PRWEB) December 17, 2014 ... (Euronext: IPN; ADR: IPSEY), today ... mg (referred to as Somatuline®) was approved by ... the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) in ... locally advanced or metastatic disease to improve progression-free ...
(Date:12/17/2014)... Diego, CA (PRWEB) December 17, 2014 ... and activation agency and member of the Huntsworth Health ... Gonzales to its executive team. In her role, Gonzales ... , “We are incredibly honored to welcome a ... Agency Chief and CEO, Gaëtan Fraikin. “She is a ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2
... (1/25/11) -- Researchers from Boston College, MIT, Clemson and ... increase in the thermoelectric figure of merit of p-type ... in the American Chemical Society journal Nano Letters ... merit, used to measure a material,s relative thermoelectric performance, ...
... Inc. (Nasdaq: CEPH ) today announced positive ... (armodafinil) Tablets [C-IV] in patients experiencing excessive sleepiness associated ... their night shifts (i.e., 4:00 a.m. to 8:00 a.m.), ... significant difference in improvement in overall clinical condition related ...
... 2011 RxTrials, Inc., a network of premier clinical ... leading national clinical research consultant and education provider, has ... WBE certification was presented by the Women,s Business Enterprise ... site visit. The nationally recognized certification from ...
Cached Biology Technology:Nanotech milling produces dramatic increase in thermoelectric performance of bulk semiconductor 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 3Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 4RxTrials Earns National Women-Owned Business Certification 2
(Date:12/10/2014)... Dec. 9, 2014  Wake Forest Baptist Medical Center today ... its School of Medicine. Funding for this $50 million ... that will be publicly launched next summer. ... the former 60 series R.J. Reynolds Tobacco Company complex, ... will begin immediately with plans to be ready to ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
(Date:11/21/2014)... 19, 2014  Earlier this year Donald Spector ... and one of the most prolific inventors in the ... transmitted from Smartphones to third party agencies. Spector envisioned ... one of the earliest known patents in this area. ... the military, child care, elder care and hospital applications. ...
Breaking Biology News(10 mins):Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4
... been found in male cichlid fish that evolved to lure ... the females mouths. A study in the online open access ... egg-like markings on the fins of cichlid fishes and uncovers ... the success of the fishes, exotic oral mating behaviour. ...
... TORONTO, ON Researchers are closer to understanding why ... they look, behave, think, and fight off disease, despite ... Innovative research from the University of Torontos ... new explanations for these glaring differences. In comparing brain ...
... The first State of the Carbon Cycle Report for North ... Science Program, finds the continents carbon budget increasingly overwhelmed by ... tons of carbon into the atmosphere each year, mostly as ... may remove up to half this amount, but these current ...
Cached Biology News:University of Toronto finds humans and chimps differ at level of gene splicing 2First-ever 'State of the Carbon Cycle Report' finds troubling imbalance 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: