Navigation Links
Slone Partners CEO & President Speak about Hiring Challenges in Molecular Diagnostics at Executive War College 2013
Date:4/10/2013

Miami Beach, FL (PRWEB) April 10, 2013

Slone Partners CEO Adam Slone and President Tara Kochis will present their ideas for securing top talent in the increasingly competitive, cost-conscious diagnostic and laboratory testing industries market, in a session at the Executive War College Conference in New Orleans, La. April 30.

Their presentation, “Grow, Sell, or Become Extinct,” will provide executives a perspective from the point of view of a national recruiting firm on the importance of identifying and hiring the personnel who are essential to business growth and success.

“Personalized Medicine and Molecular Diagnostics are expected to be one of America’s fastest-growing sectors during this decade,” said Mr. Slone, “and the people that the diagnostic and laboratory testing industries hire will be the difference between winning in that environment or falling behind.”

“Executives today have three mandates—do more, do it faster, do it with less,” said Ms. Kochis. “A good company can usually accomplish two of those, but to do all three you need the very best people you can find. A gap in talent has greater consequences than in the past.”

The presentation, at 8:00 am ET Tuesday, April 30, will also detail the positions most in demand today and offer specific guidelines on how to evaluate a recruitment firm.

The 18th Annual Executive War College Conference on Laboratory and Pathology Management will be held at the Sheraton New Orleans Hotel April 30-May 1. More details are available at the conference website.

About Slone Partners:
Slone Partners is a premier
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Chemical Publishing Company Partners with Author Cloudware for a Digital eBook Distribution for Water Treatment, Waste Water Treatment, and Cooling Water Treatment Titles
2. ChanTest Announces Their Second User Meeting: Partnerships in Drug Discovery
3. Blanchette Rockefeller Neurosciences Institute Partners with Neurotrope BioScience to Advance New Alzheimers Disease Discoveries
4. Seahorse Bioscience Launches First Product from the Partnership with Baystate Medical Center and UMass Amherst
5. Business Intelligence Consulting Firm NuWare Partners With Yellowfin To Deliver Easy-to-use BI Solutions
6. RoviSys Partners with POMS MES to Expand Life Sciences Capabilities
7. NineSigma Announces Winners in $25,000 Sustainable Packaging Challenge in Conjunction With Scientists Without Borders and Partners
8. Accelrys Announces Strategic Partnership with USDM
9. WaferGen Partners with Salk Institute to Establish a Nano-qPCR Core Lab
10. Abacus International Expands Annual Partnership With HealthEconomics.Com
11. Enterprise Mobility players NuWare & VeliQ form a global partnership to deliver mPaaS solutions
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: