Navigation Links
Skin & Allergy News Digital Network Launches Product Zone
Date:8/2/2010

MORRISTOWN, New Jersey, August 2, 2010 /PRNewswire-FirstCall/ -- Skin & Allergy News Digital Network, a part of International Medical News Group, LLC, an Elsevier company, announces the launch of Product Zone on its site, http://www.skinandallergynews.com. Product Zone is a targeted product and digital resource center designed to assist dermatologists, physicians, and related healthcare professionals in making informed purchasing decisions. This new resource will provide immediate and comprehensive access to critical information used in the medical buying process, including videos, white papers, webcasts, case studies, and additional content delivered in more than 20 digital formats. The new Product Zone launches with more than 4,000 product, company and resource listings devoted exclusively to the dermatology market.

"The medical purchasing process is becoming increasingly complex as buyers are relying more and more on a variety of online information sources including vendor content, digital resources, and independent research," said Alan Imhoff, President of International Medical News Group (IMNG). "We launched the new Product Zone to provide the most extensive information resource of its type. No other dermatology product information resource features this scope and depth. Along with the Product Zone, we will also announce a new series of online media programs to help our advertisers educate their prospects and establish leadership positions within their product categories as well as qualify validated sales leads."

The onl
'/>"/>

SOURCE Elsevier
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4 5

Related biology technology :

1. European Union Approves Maize with Herculex® I/Herculex® RW and Herculex® RW/ Herculex® I/Roundup Ready® Corn 2 Trait Stacks for Import, Food, Feed & Processing
2. Renhuang Receives AAA(1) Rating from Chinese Academy of International Trade & Economic Cooperation of Ministry of Commerce
3. David Blumenthal, HHS National Coordinator for Health Information Technology, to Speak at Lucian Leape Institute Third Annual Forum & Gala on Sept. 16
4. Webcast Alert: Cytomedix Inc (GTF) Announces the LHA Life Sciences & Med Tech Day 2010 Presentation
5. Webcast Alert: Senesco Technologies (SNT) Announces the LHA Life Sciences & Med Tech Day 2010 Presentation
6. FightSMA Launches Gene Therapy Fundraising Campaign: “Realizing the Dream”
7. CBR Pharma Insights' Latest Report, The New Era of Healthcare Reform - Supporting Revenue Growth through Understanding & Adaptation
8. ‘Next Big Idea' Fest Aims to Spark Interest Among NM Youth in Science, Technology as Future Career Path
9. Carl Zeiss Offers Online Promotions – Discounts on Stereomicroscopy and Converting to 3D Imaging
10. Stemedica Announces the Appointment of Dr. Csar Amescua Garcia as Medical and Regulatory Affairs Director – Latin America
11. DuPont Named to Biofuels Digest 2010 “Transformative Technologies 303
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... . -- Fiserv, Inc. said its Interactive Technologies ... A. Weber chief operating officer. In her new ... the Interactive Technologies Advantage Fee System software and ... clients. , ,Weber joins Interactive Technologies from ...
... biotechnology sector, she began to notice a certain pattern: Scientists ... the business world to be a much different place than ... , ,"Along the way, I realized that it was that ... a product just as effectively as a competitor," Villars said. ...
... J.J. Keller & Associates is launching Prospera ... tested on more than 13,000 human resources professionals, the ... built around five areas of concern for human resources ... on how those areas affect a company's bottom line; ...
Cached Biology Technology:Can tech people be business leaders? Upcoming seminar may have the answer 2Can tech people be business leaders? Upcoming seminar may have the answer 3J.J. Keller, Modine Manufacturing, Gustave A. Larson Co., Esker, Firstlogic, Software One 2
(Date:6/18/2013)... D.C. June 18, 2013 Joshua Obar, Ph.D., ... has been honored with a 2013 ICAAC Young Investigator ... regulation of immunological memory responses to infection. , ... University in 2001 and went on to complete his ... 2006. He performed his Ph.D. thesis research in ...
(Date:6/18/2013)... Irvine, Calif., June 18, 2013 The herbal extract ... relief was found to increase the lifespan of fruit ... to UC Irvine researchers. , But it,s how ... root, did this that grabbed the attention of study ... Rhodiola works in a manner completely unrelated ...
(Date:6/18/2013)... to a chemical modification of DNA and this ... the DNA sequence. Until now, scientists believed that ... certain genes. Today, a team of researchers from ... Emmanouil Dermitzakis, Louis-Jeantet Professor at the Faculty of ... case and that DNA methylation may play both ...
Breaking Biology News(10 mins):The American Society for Microbiology honors Joshua Obar 2Herbal extract boosts fruit fly lifespan by nearly 25 percent, UCI study finds 2The secret of DNA methylation 2
... A newly discovered mechanism by which an infectious fungus ... virulence, according to Howard Hughes Medical Institute investigators at ... in light following fungal invasion of the human body ... sparks infection, the researchers said. , The discovery in ...
... irreversible damage to the heart that can cause ... the limited ability of the myocardium to regenerate ... University now document the existence of a previously ... with therapeutic potency for myocardial tissue regeneration following ...
... (WHO) warned about increased risk of vector-borne diseases ... areas in Southeast Asia. Nearly four weeks after ... the organization is strengthening its disease surveillance, stagnant ... multiply to sufficient levels, to potentially cause severe ...
Cached Biology News:Light therapy may combat fungal infections, new evidence suggests 2Light therapy may combat fungal infections, new evidence suggests 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 2WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 4
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: