Navigation Links
Silence Obtains Important Patent Protection for Lead Internal Development Compound, Atu027
Date:7/23/2008

European Patent Office Notifies Company of Intent to Grant Patent

LONDON, July 23 /PRNewswire/ -- Silence Therapeutics plc (AIM: SLN), a leading European RNAi focused biotechnology company, today announces new intellectual property cover for its lead product, Atu027. The European Patent Office announced on July 17, 2008 that it intends to grant a European patent covering Silence's lead internal product candidate. This patent will give Silence broad exclusivity not only for Atu027, but for any siRNA targeting protein kinase N beta.

The notice is based on European patent application EP 03 790 894.4. The claims deemed allowable by the European Patent Office are directed to various aspects of the use of protein kinase N beta, the gene target of Atu027. Among others, the claims are related to any siRNA molecule, including Atu027, directed against protein kinase N beta for use in the treatment of numerous cancers involving the PI3-kinase pathway. Other claims are related to the use of protein kinase N beta for screening purposes and its use as a downstream target of the PI3-kinase pathway.

Atu027 is a proprietary AtuRNAi molecule currently in development for solid cancer indications, including gastrointestinal and lung cancers. The candidate is designed to silence the function of a novel kinase protein involved in tumour growth and metastases and utilizes Silence Therapeutics's proprietary drug delivery system AtuPLEX to deliver active drug into the appropriate cells following systemic administration.

"The protection of targets through composition of matter patents is an important part of our patent strategy," said Iain Ross, Chairman and CEO of Silence Therapeutics. "The notice of intent to grant represents a significant step forward for the Group in both its own programs and those of its collaborators, as it provides intellectual property cover not only for the Company's lead product, Atu027, but also broad exclusivity for any siRNA t
'/>"/>

SOURCE Silence Therapeutics plc
Copyright©2008 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Silence Therapeutics and AstraZeneca Announce Collaboration to Develop Novel Approaches for siRNA Drug Delivery
2. FDA Approves Quark IND for DGFi, an siRNA Therapeutic Based on Silence Therapeutics Unique Proprietary Chemistry
3. Silence Therapeutics Announces Successful Opposition of Glover Patent
4. Organizational Changes at Silence Therapeutics
5. Intellect Neurosciences, Inc. Obtains Validation of European Patent for Alzheimers Vaccine in 19 Countries
6. Botaneco obtains $2.4 million in funding from AVAC
7. Ganeden Biotech Obtains Self-Affirmed GRAS Status for Probiotic Ingredient, GanedenBC30 (Bacillus coagulans GBI-30, 6086)
8. Neptune Technologies & Bioressources Inc. obtains Complementary Medicine approval in Australia for NKO(R)
9. NEXCORE Technology Obtains Licenses for Revolutionary Fluid Management System
10. China Kangtai Cactus Biotech, Inc. Obtains $500,000 Equity Financing
11. PerOs obtains USDA Establishment and Product Licenses for its oral vaccine formulations
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: