Navigation Links
Sigma-Aldrich(R) Focuses on Biology With Launch of New Life Science Brand Platform
Date:3/2/2010
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Group today announced its,plans to seek a listing of ... Europe and the Middle East. In a statement released ... Oji said that "this,was part of a comprehensive growth ... years. Chrome recently signed a Memorandum,of Understanding with Petrobras ...
... agent to move forward in Phase III ... PeriCor Therapeutics announced today,that its licensing agreement ... The agreement grants Schering-Plough exclusive,worldwide rights for ... acadesine. Financial terms of the transaction were ...
... Advanced Cell,Technology, Inc. (OTC Bulletin Board: ACTC) ... plans to privately offer up to $10,000,000,of senior ... the,closing of the offering will be subject to ... to be used to fund working capital, including,costs ...
Cached Biology Technology:Chrome Group to Seek Listing for Some of its Subsidiaries 2Chrome Group to Seek Listing for Some of its Subsidiaries 3Chrome Group to Seek Listing for Some of its Subsidiaries 4PeriCor Therapeutics Announces Closing of Licensing Agreement for Acadesine with Schering-Plough Corporation 2PeriCor Therapeutics Announces Closing of Licensing Agreement for Acadesine with Schering-Plough Corporation 3Advanced Cell Technology Announces Proposed Financing 2Advanced Cell Technology Announces Proposed Financing 3
(Date:6/23/2015)... BEACH GARDENS, Fla. , June 23, ... multi-factor identity management and authentication solutions, today announced ... Altus strong, multi-factor authentication solution.  The enhancements ... of use of the DigitalPersona Altus platform ... biometric reader compatibility. In today,s ...
(Date:6/17/2015)... , and HILDEN, Germany , June ... QGEN ; Frankfurt Prime Standard: QIA) today launched new Investigator ... in forensic laboratories in the United States ... to simultaneously analyze multiple key genomic markers (short tandem repeats ... Quality Sensor to evaluate the quality of DNA in ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
... Argonne National Laboratory has signed a memorandum ... (SRNL) to collaborate on nuclear energy and environmental ... Energy Department (DOE) needs and other important national ... a leader in nuclear energy research," Argonne director ...
... Maneuvering through a room full of people. Jumping out of ... these seemingly simple actions require us to perceive and quickly ... Rensselaer Polytechnic Institute Mark Changizi argues they require something moreour ... nearly one-tenth of a second to translate the light that ...
... has detected the molecule hydroxyl on another planet for ... new tool to unlock the workings of Venuss dense ... made up of a hydrogen and oxygen atom each. ... the Venusian atmosphere, some 100 km above the surface, ...
Cached Biology News:Argonne-SRNL agreement supports critical DOE, national priorities 2Crystal (eye) ball: Study says visual system equipped with 'future seeing powers' 2Crystal (eye) ball: Study says visual system equipped with 'future seeing powers' 3Key molecule discovered in Venus's atmosphere 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: