Navigation Links
'Sifting' liquid at the molecular level
Date:7/17/2012

Drexel University engineers continue to drive research into the use of carbon nanotubes, straw-like structures that are more than 1,000 times thinner than a single human hair. Their most recent development uses the tiny tubes to separate liquids within a solution.

The researchers have shown that individual carbon nanotubes can act as a separation channel that would force two differing molecules to separate as easily as oil and water. For example, the molecules that comprise two chemically distinct liquids will interact differently with the walls of the nanotube as the liquids flow through it. This will cause one of the liquids to drain through the nanoscale straw faster than the other, thus forcing a separation between the two liquids.

This technology could prove useful in a number of applications, including forensic studies with very small sample sizes and studying molecules extracted from individual cells. Forensic experts would be able to analyze trace evidence, even down to a single cell or invisible stains.

"We believe that this research will lead to development of tools for analysis on single living cells and push the limits of analytical chemistry to even smaller scales and to single organelle columns," said Dr. Yury Gogotsi, director of the A.J. Drexel Nanotechnology Institute.

Gogotsi and Dr. Gary Friedman, director of the Drexel Plasma Medicine Lab and a professor of electrical and computer engineering, were the lead researchers on a study about applications of nanotubes for cellular chromatography that was recently published in Nature Publishing Group's Scientific Reports. The research was funded by a grant from W.M. Keck Foundation and the National Science Foundation's National Interdisciplinary Research Teams program.

The carbon nanotubes used in this study measure as small as 70 nanometers in outer diameter and are currently the smallest chromatography columns ever made. The carbon nanotube c
'/>"/>

Contact: Britt Faulstick
bef29@drexel.edu
215-895-2617
Drexel University
Source:Eurekalert

Page: 1 2

Related biology technology :

1. First atomic-scale real-time movies of platinum nanocrystal growth in liquids
2. Are those liquids explosive?
3. Liquid, Ammonium Ion-Free Glutathione Reductase Enzyme Introduced by Bio-Research Products
4. Neogen launches the fastest molecular pathogen test
5. Strange cousins: Molecular alternatives to DNA, RNA offer new insight into lifes origins
6. GenScript Rush Gene Synthesis - Driving Molecular Biology Research Faster
7. Molecular graphene heralds new era of designer electrons
8. Molecular Detection Inc. Completes $1.5 Million Financing to Advance New Tests for Sepsis and GI Disorders
9. New England Biolabs Signs Agreement with Synthetic Genomics Inc. to Launch Gibson Assembly™ Master Mix for Molecular and Synthetic Biology Applications
10. Accelerate Brain Cancer Cure and Exosome Diagnostics Collaborate to Advance Clinical Studies of Exosome Biofluid Molecular Diagnostics Technology in Brain Cancer
11. Life Technologies Partners With DaAn Gene to Develop and Commercialize Molecular Diagnostic Assays in China
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: