Navigation Links
Separation Systems for Commercial Biotechnology
Date:9/21/2011

Y METHOD OF SEPARATION,

2011 AND 2016 ($ MILLIONS) 8

CHAPTER THREE: OVERVIEW 9

BIOMOLECULAR SEPARATION SYSTEMS 9

TABLE 1 GLOBAL MARKET RANKING FOR COMMERCIAL BIOTECH

SEPARATION SYSTEMS, 2011 AND 2016 (%) . 10

RED BIOTECHNOLOGY . 10

WHITE BIOTECHNOLOGY . 10

GREEN BIOTECHNOLOGY 11

BLUE BIOTECHNOLOGY ... 11

ANALYTICAL, PREPARATIVE, AND PRODUCTION SCALE

PROCESSES . 12

ANALYTICAL SCALE SEPARATION PROCESSES . 12

PREPARATIVE SCALE SEPARATIONS 12

PRODUCTION SCALE SEPARATION ... 13

SCOPE 13

BIOMOLECULAR SEPARATIONS AND PURIFICATION .. 14

BIOMOLECULAR SEPARATIONS AND (CONTINUED) ... 15

BIOMOLECULAR SEPARATIONS AND (CONTINUED) ... 16

BIOMOLECULAR SEPARATIONS AND (CONTINUED) ... 17

Biomolecular Separations and Purification (Continued) 18

SEPARATION TECHNOLOGY: CURRENT TRENDS .... 19

SEPARATION TECHNOLOGY . 19

TABLE 2 MAJOR COMPANIES IN THE BIOMOLECULAR

SEPARATION MARKET AND MAJOR PRODUCT AREAS, 2011 . 20

TABLE 2 (CONTINUED) ... 21

DRIVERS AND RESISTORS FOR BIOMOLECULAR SEPARATION

MARKET .. 21

DRIVERS . 21

RESISTORS .. 22

COMMERCIAL BIOMOLECULAR SEPARATION MARKET .. 22

PROTEINS ... 22

Proteins (Continued) .. 23

ANTIBODIES .... 24

ENZYMES .... 25

NUCLEIC ACIDS ... 25

Nucleic Acids (Continued) .... 26

HORMONES 27

CELLS 27

BLOOD AND SERUM PRODUCTS .... 28

ORGANIC PRODUCTS ... 29

TABLE 3 GLOBAL MANUFACTURE OF BULK CHEMICAL

SUBSTANCE BY BIOCATALYSIS, 2010 (METRIC TONS) 29

COMMERCIAL SEPARATION SYSTEMS END-USE MARKETS 30

END USERS OF BIOTECHNOLOGY SEPARATION SYSTEMS . 30

Pharmaceuticals .... 30

Food, Cosmetics, and Agriculture .. 31

Energy 32

COMMERCIAL BIOTECHNOLOGY SEPARATION SYSTEMS ENDUSER

DISTRIBUTION WITHIN THE U.S. MARKET .... 32

BIOT
'/>"/>

SOURCE Reportlinker
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11

Related biology technology :

1. Reportlinker Adds 2010 Membrane and Separation Technology Research Review
2. Air Filtration and Gas/Solid Separation Training by the American Filtration and Separations Society
3. Water Filtration and Liquid Separation Training by the American Filtration and Separations Society.
4. American Filtration and Separations Society to Hold 23nd Annual Technical Conference
5. Rapid heating prepares energy-saving zeolite for greater role in industrial separations
6. HybridSPE(TM)-Precipitation Technology Wins SelectScience.net 2009 Scientists Choice Award for Best New Separations Product in 2008
7. University of Minnesota Professor Dr. David Pui to Speak at American Filtration and Separation Society Conference
8. Supelco(R) Expands Ascentis(R) Express HPLC Columns Line for High-Speed and High-Efficiency Separations
9. Clinical Integration Enables Leading Health Systems to Deliver Higher Quality, Cost-Effective Care
10. Infrared Systems International Reflects on Past and Looks Forward to the Future
11. Virginia Tech Photonics Center to develop sensors to keep power systems clean, safe
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: