Navigation Links
Selexis SA to Speak on Next Generation Innovations for Secretion Bottlenecks at the 2013 Protein Engineering Summit (PEGS)
Date:4/23/2013

Geneva, Switzerland (PRWEB) April 23, 2013

Geneva, Switzerland - April 23, 2013 – Selexis SA, a serial innovation company focused on drug discovery for lead identification and cell line development for scale-up and manufacturing of therapeutic protein drugs, announced today the Company’s vice present of business development, Andrew Sandford, will be speaking on The Selexis SURE CHO-Mplus™ Libraries: Next Generation Innovation for Addressing Difficult-to-Express Proteins at the 2013 PEGS Summit on Wednesday, May 1, 2013 at the Seaport World Trade Center in Boston, Massachusetts. Selexis will also be exhibiting at the conference, April 29 – May 3, 2013.

Andrew Sandford’s lecture is part of the Engineering Antibodies track. Conference attendees can hear Mr. Sandford’s lecture on Wednesday, May 1 at 3:05 PM.

Presentation Abstract:
Tackling production bottlenecks with difficult-to-express (DTE) proteins can significantly delay development programs. The SURE CHO-Mplus™ Libraries, the newest innovation from the SUREtechnology Platform™, consists of proprietary libraries specifically designed to address a range of production bottlenecks, including metabolic limitations, trafficking backlogs, improper folding and altered post-translational modifications. The libraries allow for parallel experimentation to overcome DTE protein development issues in a shorter timeframe.

Additionally, conference attendees can meet Selexis representatives at Booth 321, April 29 – May 3. To schedule meetings in advance, please contact Selexis at SURE@selexis.com.

Registration for the PEGS conference is required. For more information, visit http://www.pegsummit.com/

About Selexis SA
Headquartered in Geneva, Switzerland, Selexis SA is a global
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Selexis SA to Present at Biotech Showcase 2012
2. Selexis SA Appoints Yemi Onakunle as Vice President of Strategic and Market Development
3. Data on the Selexis SUREtechnology Platform to be Presented at PEPTALK 2013
4. Selexis SA to Present at Cell Line Development and Engineering 2013
5. Senior Management of NeoStem and Its Subsidiaries Invited to Speak at Seventh International Conference on Cell Therapy for Cardiovascular Disease
6. Synteract Director of IT Services Toby Odenheim Speaking at March 2012 Outsourcing in Clinical Trials East Coast Conference
7. Luminex Corporation to Speak at Joint Department of Defense and Environmental Protection Agency 5th National Bio-Threat Conference
8. National Defense Industrial Association's (NDIA) 2012 Biosurveillance Conference To Feature Keynote Speaker Laurie Garrett, Pulitzer Prize Winner and Bestselling Author
9. Bunker Hill Community College Student Speaks at 2012 BIO International Convention
10. Human Genome Decoder and Artificial Life Creator, J. Craig Venter to Speak at "The Atlantic Meets the Pacific"
11. VBI’s Dr. Szczepan Baran is an Invited Speaker at the Swiss Laboratory Animal (SGV) National Meeting
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACE™ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: