Navigation Links
Schering-Plough Schedules Webcast for Annual Meeting of Shareholders
Date:5/9/2008

KENILWORTH, N.J., May 9 /PRNewswire-FirstCall/ -- Schering-Plough Corporation (NYSE: SGP) will hold its Annual Meeting of Shareholders Friday, May 16, 2008, in Memphis, Tenn. At 8 a.m. (CDT) (9 a.m. EDT) on that day, a live Webcast of the meeting will be available to all interested parties via the corporate Web site, http://www.schering-plough.com.

At the Annual Meeting, Fred Hassan, Chairman and CEO, will report to shareholders on the company's performance and the progress being achieved toward its long-term goals.

Those wishing to listen live to the Webcast of the Annual Meeting should go to the Investor Relations section of the Schering-Plough corporate Web site, http://www.schering-plough.com, and click on the "Presentations/Webcasts" link. A replay of the Webcast will be available via the Web site later that day.

Schering-Plough is an innovation-driven, science-centered global health care company. Through its own biopharmaceutical research and collaborations with partners, Schering-Plough creates therapies that help save and improve lives around the world. The company applies its research-and-development platform to human prescription and consumer products as well as to animal health products. Schering-Plough's vision is to "Earn Trust, Every Day" with the doctors, patients, customers and other stakeholders served by its colleagues around the world. The company is based in Kenilworth, N.J., and its Web site is http://www.schering-plough.com.


'/>"/>
SOURCE Schering-Plough Corporation
Copyright©2008 PR Newswire.
All rights reserved

Page: 1

Related biology technology :

1. Intervet/Schering-Plough Animal Health Outlines Strength of the Combination
2. Schering-Plough/MERCK Pharmaceuticals Receives Not-Approvable Letter from FDA for Loratadine/Montelukast
3. Schering-Plough CEO Buys $2 Million in Common Shares
4. Schering-Plough Announces Planned Divestiture of Select Animal Health Products in Europe
5. Schering-Plough Reports Financial Results for First Quarter of 2008
6. Schering-Plough Schedules Conference Call and Webcast for 2008 First Quarter Earnings
7. Schering-Plough Launches Productivity Transformation Program To Confront New Challenges
8. Centocor, Inc. and Schering-Plough Submit Application Requesting Approval of Golimumab in Europe for the Treatment of Rheumatoid Arthritis, Psoriatic Arthritis and Ankylosing Spondylitis
9. Schering-Plough Announces Filing of U.S. Application for OTC ZEGERID(R)
10. Schering-Plough Reports Financial Results for 2007 Fourth Quarter, Full Year
11. Schering-Plough and OraSure Technologies Sign International Collaboration for Rapid Point-of-Care Oral Hepatitis C Test
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: