Navigation Links
Schering-Plough Announces Pricing of Senior Notes Offering
Date:9/12/2007

rk, New York, 10004, Phone: 1-866-471-2526, Fax: 212-902-9316 or email at prospectus-ny@ny.email.gs.com, BNP Paribas Securities Corp. toll-free at 1-800-854-5674, Credit Suisse Securities (USA) LLC toll-free at 1-800-221-1037 or J.P. Morgan Securities Inc. at 1-212-834-4533.

Schering-Plough is a global science-based company that discovers, develops and manufactures pharmaceuticals for three customer markets -- human prescription, consumer and animal health. While most of the research and development activity is directed toward prescription products, there are important applications of this central research and development platform into the consumer healthcare and animal health products. Schering-Plough also accesses external innovation via partnering, in-licensing and acquisition for all three customer markets. Schering-Plough is based in Kenilworth, N.J.

DISCLOSURE NOTICE: The information in this press release and other written reports and oral statements made from time to time by Schering-Plough may contain "forward-looking statements" within the meaning of the Private Securities Litigation Reform Act of 1995. Forward-looking statements do not relate strictly to historical or current facts and are based on current expectations or forecasts of future events. You can identify these forward- looking statements by their use of words such as "anticipate," "believe," "could," "estimate," "expect," "forecast," "project," "intend," "plan," "potential," "will," and other similar words and terms. Actual results may vary materially from Schering-Plough's forward-looking statements, and there are no guarantees about the performance of Schering-Plough stock or Schering- Plough's business. Schering-Plough does not assume the obligation to update any forward-looking statement. A number of risks and uncertainties could cause results to differ materially from forward-looking statements. For further details of these risks and uncertainties that may impact forward- looki
'/>"/>

SOURCE Schering-Plough Corporation
Copyright©2007 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Speaker announces business members of IT Task Force
2. Doyle announces technology tax credits for Berbee
3. Doyle announces new energy, global warming policies
4. Doyle announces $80M renewable energy strategy
5. GE announces first installation of Discovery VCT
6. UWM announces winners of RGI awards
7. Third Wave announces two senior management appointments
8. Mirus announces new method for making antibodies
9. Merge announces sofware updates, upcoming acquisition
10. Small Tree announces ethernet solution for Apple Xserv G5
11. TEKLYNX International announces new RFID software
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: