Navigation Links
SPIE Names 69 New Fellows of the Society in 2013
Date:1/18/2013

BELLINGHAM, WA, USA (PRWEB) January 18, 2013

SPIE will promote 69 new Fellows of the Society this year, to recognize the significant scientific and technical contributions of each in the multidisciplinary fields of optics, photonics, and imaging. SPIE Fellows are honored for their technical achievements and for their service to the general optics community and to SPIE in particular. More than 1,000 SPIE members have become Fellows since the Society’s inception in 1955.

The annual recognition of Fellows provides an opportunity for SPIE to acknowledge Members for their outstanding technical contributions and service to SPIE.

“The SPIE Fellow award is given only for the highest technical achievement in optics and photonics, and friends and colleagues of the winners should be aware of the special nature of this prize,” said William Arnold, 2013 SPIE President. “All of us congratulate these extraordinary people for their accomplishments.”

This year’s honorees include its first members elected from Iceland and South Africa.

“The 2013 Fellows are recognized for outstanding academic achievements in optics, photonics and significant contributions in the optical community and SPIE leadership. Congratulations to them all,” said Cheng-Chung Lee, National Central University (Taiwan), chair of the 2012 SPIE Fellows Committee. “The Fellows Committee continues to encourage the nominations of deserving candidates for next year's awards.”

Fellows are recognized at SPIE meetings of their choice throughout the year. This year, new Fellows are scheduled to be inducted at SPIE Photonics West, SPIE Advanced Lithography, SPIE Smart Structures, SPIE Defense, Security and Sensing, SPIE Optics + Photonics, and other SPIE meetings.

For a complete listing and photos of the 2013 SPIE Fellows visit http://spie.org/x32.xml.

For a c
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. PathoGenetix Names Ann Merrifield as Chief Executive Officer and Prepares to Launch Unique Bacterial Identification Technology
2. AtheroNova Names New Director
3. FierceBiotech Names Enanta Pharmaceuticals, Inc. a Fierce 15 Winner
4. Amgen Names Ray Jordan Senior Vice President, Corporate Affairs
5. Islet Sciences Names Richard A. Franco, Sr. to its Board of Directors
6. Elsevier / MEDai Names Dr. Peter Edelstein as Chief Medical Officer and Dr. Gerald Osband as Director of Product Strategy
7. PharmaVOICE Names Four inVentiv Health Associates Among "100 Most Inspiring" Leaders in Healthcare
8. Lloyd Library and Museum Names ABCs Blumenthal to New Honorary Advisory Board
9. Ethical Corporation Names Life Technologies First CSO Sustainability Executive of the Year
10. Triple-S Management Corporation Announces the Retirement of Socorro Rivas-Rodriguez; Names Pablo Almodovar Scalley as Successor
11. 23andMe Names Andy Page to Board of Directors
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACE™ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: