Navigation Links
Royalty Pharma Statement Regarding Elan Proposal
Date:3/6/2013

made, Elan Shareholders, as opposed to Elan, would be able to reinvest any cash proceeds in other pharmaceutical companies without paying the control premium which Elan may need to pay to acquire control of such companies.

In the event that the Possible Offer is not made, Elan Shareholders will have limited control over what assets Elan might acquire (as shareholder approval may not be required). Royalty Pharma believes that the risks associated with Elan's future acquisition strategy, and the impact of this strategy on earnings visibility, are substantial.

Furthermore, unlike the "unique" dividend policy announced by Elan on March 4, 2013 whereby Elan Shareholders receive only 20 percent of the Tysabri Royalty over time, the Proposal would allow Elan Shareholders to receive what Royalty Pharma believes is full value for their Elan Stock immediately upon the completion of an offer.

Royalty Pharma's perspective on the assets, attributes and liabilities of Elan today is contained below.

Elan's hard assets

Royalty Pharma believes that substantially all of Elan's assets, following the completion of the Tysabri Transaction, will consist only of net cash of US$3.1 billion[1] or US$5.1 per Elan Stock[2] (to which Royalty Pharma does not ascribe a premium) and the Tysabri Royalty, of which Biogen now has full operating control.

Royalty Pharma believes that the Tysabri Royalty is a financial rather than strategic asset and should therefore be valued on the basis of financial metrics (i.e. intrinsic value). As described elsewhere in this announcement, Royalty Pharma has prepared an illustrative calculation, which assumes that the Disposed Tysabri Percentage is between 46 percent and 54 percent. Using the mid-point of the Disposed Tysabri Percentage Range would indicate that the Tysabri Transaction ascribed a value of US$3.25 billion (US$5.4 per Elan Stock) to the residual Tysabri Royalty.

Royalty Pharma further believes
'/>"/>

SOURCE RP Management, LLC
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31

Related biology technology :

1. PDL BioPharma Provides Third Quarter 2012 Royalty Revenue Guidance of $85 Million
2. Cowen Healthcare Royalty Partners Raises $1 Billion
3. Array Biopharma and Global Blood Therapeutics Announce Drug Discovery Collaboration Focused on Hematology
4. Radiopharmaceuticals Market - Global Industry Analysis, Size, Share, Trends And Forecast, 2012 - 2018: MarketResearchReports.Biz
5. Alexandria Real Estate Equities, Inc. Announces Long-Term Lease with Leading Global Commercial-Stage Oncology Company, Onyx Pharmaceuticals, Inc., for New Build-to-Suit Facility in South San Francisco, California
6. AVANIR Pharmaceuticals To participate in two conferences in March
7. Favorable Scenario for Japan Pharma Industry in Coming Years, New Report Says
8. Hyperion Wins NDA Approval for UCD Drug Developed With Support from PharmaDirections
9. Technical Analysis on VIVUS and Achillion Pharma: Highlights on These Biotech Companies
10. Auxilium Pharmaceuticals, Inc. Announces Fourth Quarter and Full Year 2012 Financial Results and Guidance for 2013
11. Serialization in Pharmaceuticals, a Webinar Presented by Xtalks
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , http://www.videonewswire.com/event.asp?id=80894 How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: