Navigation Links
Roche to Acquire Ventana for $89.50 per share
Date:1/22/2008

ER STATEMENT ON SCHEDULE TO (INCLUDING THE OFFER TO PURCHASE, LETTER OF TRANSMITTAL AND OTHER RELATED TENDER OFFER MATERIALS) FILED BY ROCHE WITH THE SECURITIES AND EXCHANGE COMMISSION (THE "SEC") ON JUNE 27, 2007. THESE MATERIALS, AS THEY MAY BE AMENDED FROM TIME TO TIME, CONTAIN IMPORTANT INFORMATION, INCLUDING THE TERMS AND CONDITIONS OF THE OFFER, THAT SHOULD BE READ CAREFULLY BEFORE ANY DECISION IS MADE WITH RESPECT TO THE TENDER OFFER. INVESTORS AND SHAREHOLDERS CAN OBTAIN A FREE COPY OF THESE MATERIALS AND OTHER DOCUMENTS FILED BY ROCHE WITH THE SEC AT THE WEBSITE MAINTAINED BY THE SEC AT http://WWW.SEC.GOV. THE TENDER OFFER MATERIALS MAY ALSO BE OBTAINED FOR FREE BY CONTACTING THE INFORMATION AGENT FOR THE TENDER OFFER, MACKENZIE PARTNERS AT (212) 929-5500 OR (800) 322-2885 (TOLL-FREE).

VENTANA'S STOCKHOLDERS SHOULD READ THE COMPANY'S SOLICITATION/RECOMMENDATION STATEMENT ON SCHEDULE 14D-9, WHICH WAS FILED WITH THE SECURITIES AND EXCHANGE COMMISSION ("SEC") ON JULY 11, 2007, AND ANY AMENDMENTS OR SUPPLEMENTS THERETO. THE COMPANY'S SOLICITATION/RECOMMENDATION STATEMENT SETS FORTH THE REASONS FOR THE RECOMMENDATION OF THE VENTANA BOARD AND RELATED INFORMATION. THE SOLICITATION/RECOMMENDATION STATEMENT AND OTHER PUBLIC FILINGS MADE FROM TIME TO TIME BY THE COMPANY WITH THE SEC ARE AVAILABLE WITHOUT CHARGE FROM THE SEC'S WEBSITE AT http://WWW.SEC.GOV, AT VENTANA'S WEBSITE AT http://WWW.VENTANAMED.COM OR FROM VENTANA'S INFORMATION AGENT, INNISFREE M&A INCORPORATED AT (888) 750-5834.


'/>"/>
SOURCE Roche; Ventana Medical Systems
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6

Related biology technology :

1. Roche Extends Tender Offer for Ventana
2. Amic Signs Non-Exclusive License Agreement With Roche Diagnostics for Key Cardiac Marker NT-proBNP
3. Roche Files IND for Second Genmab Antibody
4. Fourth Genmab Antibody Developed Under Roche Collaboration to Enter Clinic
5. Roche to Nominate Independent Directors for Election at Ventanas 2008 Annual Stockholders Meeting
6. MacroChem to Present at Equities Magazine Conference December 7, 2007 in New York
7. Roche Diagnostics Launches CoaguChek XS Plus System to Provide New PT/INR Point-of-Care Solution for Non-Waived Anticoagulation Services
8. Kosan to Reacquire Epothilone Program From Roche
9. Phase I Results Announced for R1507 From Genmabs Collaboration With Roche
10. MacroChem Announces Michael Zasloff, M.D., Ph.D. Joins Companys Scientific Advisory Board
11. MacroChem To Participate in PIPEs Conference October 18th and 19th in New York City
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... , Jan. 22, 2015  Transwestern | RBJ today announces the ... office space for Shire a leading biopharmaceutical company, at Two ... | RBJ,s Robert Richards , president, and Brian ... for the entire five-floor building at 95 Hayden Ave. ...
(Date:1/22/2015)... January 21, 2015 Cambridge Semantics, the leading ... today announced that 2014 was a record-breaking year across the ... of the Anzo Smart Data Platform and our Smart Data ... insights from diverse data which led to record growth for ...
(Date:1/22/2015)... January 22, 2015 Crystal Diagnostics (CDx) Xpress ... it has received AOAC-PTM Certifications for the six non-O157 Shiga ... O145; collectively referred to as STEC or the “Big-6”) as ... forming unit (cfu) per 325 g of raw ground beef ...
(Date:1/22/2015)... Dr. Greg Leyer of UAS Labs recently was ... Pre-Conference seminar on probiotics in San Diego, CA. , ... conference for health care professionals. This year’s pre-conference seminar was ... in health. Dr. Leyer spoke about the emerging topics and ...
Breaking Biology Technology:Transwestern | RBJ Advises Shire in 202,000 SF Lease, Creating Boston's Largest Suburban Biotech Campus 2Cambridge Semantics Announces Record Results for 2014 2Crystal Diagnostics Awarded AOAC-PTM Accreditation for the Rapid Detection of “Big 6” E.coli Food Pathogens 2
... Vaccine Induced Neutralizing Antibodies and Protected Mice upon ChallengeROCKVILLE, ... NVAX ) announced results from a preclinical study of ... the viral fusion (F) protein. The virus utilizes ... respiratory tract and cause illness. Novavax,s RSV-F ...
... Boston Scientific Corporation (NYSE: BSX ) ... ended December 31, 2008. Subsequent to the release ... a patent litigation settlement and, as expected, finalized a ... U.S. Generally Accepted Accounting Principles, these events are required ...
... 26 InterMune, Inc.,(Nasdaq: ITMN ) today announced ... December 31, 2008. InterMune reported a net loss for ... share, compared with a,net loss of $25.9 million, or $0.67 ... Dan Welch, Chairman, Chief Executive Officer and ...
Cached Biology Technology:NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 2NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 3NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 2Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 3Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 5Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 6Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 7Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 8Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 9Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 2InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 3InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 4InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 5InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 6InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 7InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 8InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 9InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 11InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 12
(Date:1/22/2015)... OXFORD, Conn. , Jan. 20, 2015 NXT-ID, Inc. (NASDAQ: ... growing mobile commerce market, reports on the recent success of the Wocket™ ... Wocket smart wallet was named as one of the ... of the "5 Best Products Launched At CES So Far" by Newseveryday.com ...
(Date:1/22/2015)... MUNICH , January 22, 2015 ... its tenth year  The European Patent Office to present ... Two British nominations to be featured: Christofer Toumazou ... week featuring former finalists and winners of the Award   ...
(Date:1/22/2015)... 2015 Infinisource has launched its new NXG series of ... G2 sets a higher standard for collecting attendance and labor ... With plug-and-play installation, touch screen interface and seamless connection to ... time collection solution for the small to mid-size employer. ...
Breaking Biology News(10 mins):CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 2CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 3Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 2Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 3Infinisource's NXG series sets new time clock standard 2
... a female insect in order to attract males for pollination. ... Biology found that breeding two of these orchid species ... This new odour had no effect on normal solitary bees ... of wild bee that never visited any of the parent ...
... , Nerve cells communicate with each other by means ... cells exchange charged ions with their environment. However, the ... although some theories predicted a relation between the chloride ... Institute of Neurobiology in Martinsried were now able to ...
... A Georgetown University Medical Center research team has been ... Abuse to discover and develop new smoking cessation drugs ... Kenneth Kellar, PhD, a professor of pharmacology at GUMC ... $4.6 million. The theory, developed in Kellar,s lab ...
Cached Biology News:Chloride channels render nerve cells more excitable 2Chloride channels render nerve cells more excitable 3GUMC to develop smoking cessation aids based on unconventional nicotine addiction theory 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: