Navigation Links
Rheumatoid Arthritis Patients Want Pain-Free Days at Christmas
Date:12/14/2009

BRUSSELS, December 14 /PRNewswire-FirstCall/ --

- Results From a Survey Conducted by UCB Assessing the Lifestyles of Women With Rheumatoid Arthritis in Seven Major Industrialized Countries

    - A third of women living with rheumatoid arthritis say their disease
      impacts their enjoyment of the festive season

    - Women living with rheumatoid arthritis find shopping for gifts,
      preparing holiday food, writing cards and wrapping presents most
      difficult to do

    - Nearly two thirds of women living with rheumatoid arthritis experience
      pain daily

A global survey reveals that rheumatoid arthritis (RA) has a severe emotional and physical impact on people living with the disease and their families. Feelings of detachment and isolation from those closest to them due to RA are especially prevalent at Christmas, which should be one of the happiest times of the year. The survey findings of 1,958 women with RA from seven countries worldwide, suggest that 35% of women living with RA feel the disease impacts on their enjoyment of family events during the festive season.

The survey, sponsored by biopharmaceutical company UCB, highlights that 23% of women living with RA find it always painful, more difficult or have stopped attending parties or celebrations due to their condition, and 44% of women with moderate to severe RA report they don't enjoy family events such as Christmas as much as they used to. Even amongst young women (25 - 35 year olds), 28% feel their enjoyment of family events is restricted due to their RA.

Personal relations are also impacted by RA with one third of women believing the condition affects their closest relationships for the worse, and more than half feel that friends and family do not understand their pain.

"The holidays are an occasion to spend fun quality time with family and friends, not a period for anxiet
'/>"/>

SOURCE UCB
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. New SIMPONI(TM) Data Show Inhibition of Joint Damage in Patients With Rheumatoid Arthritis and Psoriatic Arthritis
2. New SIMPONI(TM) Data Show Long-Term Efficacy in Treatment of Rheumatoid Arthritis
3. UCBs Cimzia(R) (certolizumab pegol), Shows Rapid and Sustained Clinical Response in Adult Patients Living with Moderate to Severe Rheumatoid Arthritis
4. New Survey Shows Devastating Impact of Rheumatoid Arthritis Pain on Intimate Relations
5. Video: New Way RA(TM) Talk Show Premieres Online for People Living With Rheumatoid Arthritis (RA)
6. New Survey Reveals That More Than Half of Rheumatoid Arthritis Patients in Europe and Canada Feel Their Disease Controls Their Lives
7. Health Canada Approves SIMPONI(TM) (golimumab) for Treatment of Rheumatoid Arthritis, Psoriatic Arthritis and Ankylosing Spondylitis
8. Antiangiogenic Role of 2ME2 Demonstrated in Rheumatoid Arthritis Models
9. Golimumab Phase 3 Data Show Significant Improvement In Physical Function In Patients with Rheumatoid Arthritis
10. Trubion Reports Re-treatment Results Following Phase 1/2a and Phase 2b Studies Evaluating TRU-015 for Rheumatoid Arthritis
11. Use of Biologic Agents Continues to Expand Among US Rheumatologists - Can New Agents Shift the Treatment Paradigm in Rheumatoid Arthritis?
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - http://photos.prnewswire.com/prnh/20110118/MM31963LOGO ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: