Navigation Links
Response Genetics, Inc. Announces Second Quarter Financial Results
Date:8/14/2012

rent beliefs and expectations of the Company's management and are subject to significant risks and uncertainties, including those detailed in the Company's filings with the Securities and Exchange Commission. Actual results, including, without limitation, actual sales results, if any, or the application of funds, may differ from those set forth in the forward-looking statements. These forward-looking statements involve certain risks and uncertainties that are subject to change based on various factors (many of which are beyond the Company's control). The Company undertakes no obligation to publicly update forward-looking statements, whether because of new information, future events or otherwise, except as required by law. RESPONSE GENETICS, INC.CONDENSED CONSOLIDATED BALANCE SHEETSDecember 31,June 30,20112012Cash and cash equivalents$

1,700,295$

2,562,262Accounts receivable, net 4,047,0594,022,555Prepaid expenses and other current assets991,351639,044Total current assets6,738,7057,223,861Property and equipment, net1,067,6791,157,657Intangible assets44,42399,477Total assets$

7,850,807$

8,480,995Accounts payable$

1,492,526$

1,203,525Accrued expenses and other current liabilities3,251,2621,912,657Other liabilities1,390,1811,318,182Common stock classified outside of stockholders' equity (deficit)7,854,68210,925,724Total stockholders' equity (deficit)(6,137,844)(6,879,093)Total liabilities, common stock classified outside of stockholders' equity (deficit) and stockholders' equity (deficit)$

7,850,807$

8,480,995 

The condensed consolidated balance sheet at December 31, 2011 is derived from the audited consolidated financial statements at the date included in the Company's Form 10-K for the fiscal year ended December 31, 2011.  The condensed consolidated balance sheet at June 30, 2012 is derived from the unaudited financial statements included in the Company's Form 10-Q for the
'/>"/>

SOURCE Response Genetics, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6

Related biology technology :

1. HemoShear Partners with Expression Analysis (EA) to Develop a Human Drug-Induced Vascular Response Database
2. NDIA, NTSA Will Be On Hand At Seventh Annual Capitol Hill Modeling and Simulation Expo, Set To Focus On Homeland Security, First Response
3. Bode Technology Launches Same-Day DNA Service For Faster Response to Law Enforcement and Justice System
4. Covenant Security Services and the Department of Homeland Security Partner to Provide Nationwide Training on Active Shooter Awareness and Response
5. Generex Subsidiary Antigen Express Announces Press Conference at American Association for Cancer Research Related to the Immunological Response of its AE37 Vaccine to Prevent Recurrence of Breast Cancer
6. US Lab Deployed to Boost Mexicos Response to Outbreaks of Infectious Disease
7. Targeted antibacterial agent rapidly created in response to serious food safety pathogen
8. Fukushima 1 year on: Poor planning hampered Fukushima response
9. Harvards Wyss Institute develops DNA nanorobot to trigger targeted therapeutic responses
10. Argos Therapeutic Arcelis™ Immunotherapy AGS-003 in Combination With Sunitinib Shows Statistically Significant Correlation of Immune System Response to Overall Survival in Phase 2 Study in Patients with Advanced Renal Cell Carcinoma (RCC)
11. "O-Shot™" May Improve Female Sexual Response
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/26/2014)... Bioscience, Inc. (NASDAQ: ROKA ), a molecular diagnostics ... of foodborne pathogens, today announced that Paul G. Thomas ... Annual Healthcare Conference on December 2, 2014 at 4:30pm ET. ... in New York, NY . ... operations, strategies and prospects may be discussed. To listen to ...
(Date:11/24/2014)...   First published articles now ... Elsevier , a world-leading provider of scientific, technical and medical ... of the latest title in the Current Opinion journal ... . Current Opinion in ... to keep up-to-date with the expanding volume of information published ...
(Date:11/24/2014)... November 24, 2014 The new ... from METTLER TOLEDO demonstrates how to reduce the ... analytics and sample panel design can be complicated, ... and protect against corrosion and deposition. Dedicated single ... significant amount of panel space. Additionally, installing and ...
(Date:11/22/2014)... 21, 2014 During his lifetime Richard ... need to surround himself with great people and take ... his friends often marveled at his extraordinarily courageous attitude ... life and -- even with his death impending—that’s how ... disease that would ultimately take his life. , Carrying ...
Breaking Biology Technology:Roka Bioscience to Present at the Piper Jaffray Healthcare Conference 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3New Video Shows How to Simplify Cycle Chemistry Sample Panels to Save Time and Costs 2Sherry Sharp, Wife of CarMax Founder, Richard Sharp, Accepts Seat on Board of Cure Alzheimer’s Fund 2Sherry Sharp, Wife of CarMax Founder, Richard Sharp, Accepts Seat on Board of Cure Alzheimer’s Fund 3
... Aug. 25 Reportlinker.com announces that a new ... Protein Kinase Therapeutics in Oncology ... http://www.reportlinker.com/p0284973/Protein-Kinase-Therapeutics-in-Oncology---Where-to-Commercialize.html This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: