Navigation Links
Researchers measure nanometer scale temperature
Date:12/19/2011

Atomic force microscope cantilever tips with integrated heaters are widely used to characterize polymer films in electronics and optical devices, pharmaceuticals, paints, and coatings. These heated tips are also used in research labs to explore new ideas in nanolithography and data storage, and to study fundamentals of nanometer-scale heat flow. Until now, however, no one has used a heated nano-tip for electronic measurements.

"We have developed a new kind of electro-thermal nanoprobe," according to William King, a College of Engineering Bliss Professor in the Department of Mechanical Science and Engineering at the University of Illinois at Urbana-Champaign. "Our electro-thermal nanoprobe can independently control voltage and temperature at a nanometer-scale point contact. It can also measure the temperature-dependent voltage at a nanometer-scale point contact."

"Our goal is to perform electro-thermal measurements at the nanometer scale," according to Patrick Fletcher, first author of the paper, "Thermoelectric voltage at a nanometer-scale heated tip point contact," published in the journal Nanotechnology. "Our electro-thermal nanoprobe can be used to measure the nanometer-scale properties of materials such as semiconductors, thermoelectrics, and ferroelectrics."

The electro-thermal probes are different than thermal nanoprobes typically used in King's group and elsewhere. They have three electrical paths to the cantilever tip. Two of the paths carry heating current, while the third allows the nanometer-scale electrical measurement. The two electrical paths are separated by a diode junction fabricated into the tip. While the cantilever design is complex, the probes can be used in any atomic force microscope.


'/>"/>

Contact: William King
wpk@illinois.edu
217-244-3864
University of Illinois College of Engineering
Source:Eurekalert  

1

GOOD

Page: 1

Related biology technology :

1. Notre Dame researchers demonstrate new DNA detection technique
2. Researchers realize high-power, narrowband terahertz source at room temperature
3. MU researchers identify key plant immune response in fight against bacteria
4. Researchers develop one of the worlds smallest electronic circuits
5. Two Top Biological Imaging Centers Offer Powerful Free Online Tool to Researchers, Educators, and Public
6. Penn and Brown researchers demonstrate earthquake friction effect at the nanoscale
7. UCLA researchers demonstrate fully printed carbon nanotube transistor circuits for displays
8. Innovative MetaMorph® NX Software Shatters Barriers Between Researchers and Image Analysis Goals with Exclusive Visual Workflow
9. Researchers shrink tumors and minimize side effects using tumor-homing peptide to deliver treatment
10. Multidisciplinary team of researchers develop world’s lightest material
11. In new quantum-dot LED design, researchers turn troublesome molecules to their advantage
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Researchers measure nanometer scale temperature
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: