Navigation Links
Regenicin to Present at Event Celebrating Advancements in Regenerative Medicine
Date:11/2/2010

NEW YORK, Nov. 2, 2010 /PRNewswire/ -- Regenicin, Inc. (OTC Bulletin Board: WDST), a biotechnology company specializing in the development of regenerative cell therapies to restore the health of damaged tissues and organs, will participate in an event to celebrate the newest advancements in regenerative medicine on November 9th, 2010 in Walkersville, MD.

Regenicin will present their role in the commercialization of the therapeutic candidate, PermaDerm™, a product which could help revolutionize the way wounded warriors and civilians recover from severe burns and wounds. Speaking on behalf of Regenicin will be Dr. Craig Eagle, a member of Regenicin's Board of Directors, and head of Oncology for Pfizer Worldwide.

The event will be hosted by Lonza Walkersville, Inc. a subsidiary of Lonza AG, a Swiss based life science company and one of the world's leading cell therapy manufacturers. Also scheduled to participate in the event are the Armed Forces Institute of Regenerative Medicine, the U.S. Department of Defense Office of Technology Transition; as well as members of Congress, U.S. Armed Forces personnel, scientists, firefighters, and surgeons on the frontlines of treating burns and wounds in the U.S.

About PermaDerm™

PermaDerm™ is the only tissue-engineered skin prepared from autologous (patient's own) skin cells from both the epidermal and dermal skin layers.  A small sample of the patient's skin can be expanded in the laboratory to cover a wound site that extends over 50% of the patient's body. These self-to-self skin grafts are intended to form permanent wound closure that is not rejected by the patient's immune system, a critical possibility in porcine or cadaver skin grafts used today.

About Regenicin, Inc.

Regenicin, Inc. is a development stage biotechnology company. Regenicin is a publicly trade
'/>"/>

SOURCE Regenicin(TM), Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Regenicin to Present Live at RetailInvestorConferences.com on November 4th
2. Regenicin Appoints Renowned New York Dermatologist, Dr. Gervaise Gerstner to Scientific Advisory Board
3. Regenicin to Form Scientific Advisory Board
4. Regenicin Names Former U.S. Marine Corp Operations Officer, Christopher Hadsall, Chief Operating Officer
5. Former Fujifilm Medical Systems USA Executive John J. Weber Agrees to Join Regenicin™ as a Member of Its Board of Directors and Interim CFO
6. Regenicin Completes Acquisition of Worldwide Exclusive Know-How Technology License from Lonza Walkersville
7. Week-24 Interim Results From Phase 2b PILLAR Study to be Presented as Late-Breaker at AASLD
8. Thrombosis Experts Present Update on Important New Developments in Anticoagulation Management
9. Investigational Data Presented for INTUNIV™ (guanfacine) Extended-Release Tablets When Coadministered With Stimulants Showed ADHD Symptom Improvement in Overall, Morning and Evening Assessments
10. CSA Medical Selected to Present at Mid-Atlantic Bio Conference
11. Beckman Coulter to Present at the Oppenheimer 21st Annual Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... , ... receptor binding assay • LEADseeker • SPA ... In mammals, serotonin (5-hydroxytryptamine, 5-HT) is a regulator ... receptors. <P ,>The serotonin 5-HT 2C receptor is a subtype ...
... , ... • whole-genome amplification (WGA),• degenerate oligonucleotideprimed PCR (DOP-PCR),• ... bacterial artificial,chromosome (BAC) array • array CGH ... , Human genomic DNA ...
... , GE Healthcare, The ... , Competitive binding assays have been ... and tyrosine kinases. Based on enzyme fragment complementation and the subsequent ... that can be read either on high-throughput imaging platforms or on ...
Cached Biology Technology:The development of a serotonin 5-HT2C receptor-binding assay using the LEADseeker Multimodality Imaging System 2The development of a serotonin 5-HT2C receptor-binding assay using the LEADseeker Multimodality Imaging System 3The development of a serotonin 5-HT2C receptor-binding assay using the LEADseeker Multimodality Imaging System 4GenomiPhi amplification of FFPE tissue DNA for array CGH 2GenomiPhi amplification of FFPE tissue DNA for array CGH 3GenomiPhi amplification of FFPE tissue DNA for array CGH 4GenomiPhi amplification of FFPE tissue DNA for array CGH 5GenomiPhi amplification of FFPE tissue DNA for array CGH 6GenomiPhi amplification of FFPE tissue DNA for array CGH 7GenomiPhi amplification of FFPE tissue DNA for array CGH 8GenomiPhi amplification of FFPE tissue DNA for array CGH 9GenomiPhi amplification of FFPE tissue DNA for array CGH 10Homogeneous, chemiluminescent kinase assay kits for assessing the functional activity of a broad range of serine-threonine and tyrosine kinases 2Homogeneous, chemiluminescent kinase assay kits for assessing the functional activity of a broad range of serine-threonine and tyrosine kinases 3
(Date:6/23/2015)... , June 22, 2015 ... announced the addition of the "Body-Worn Temperature ... Growth, Trends and Forecast 2014 - 2020" ... offers strategic analysis of the global body-worn temperature ... has been segmented on the basis of types, ...
(Date:6/23/2015)... , June 23, 2015  Crossmatch™, ... and authentication solutions, today announced enhanced functionality of ... authentication solution.  The enhancements build on the ... the DigitalPersona Altus platform and provide expanded ... In today,s environment of increasing ...
(Date:6/18/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market announces that its Wocket® smart wallet will ... the Mark", scheduled to air on WABC Radio (am770) in ... . The broadcast air- time for the ... EST. NXT-ID, Inc.,s CEO Gino Pereira will be ...
Breaking Biology News(10 mins):Body-Worn Temperature Sensors Market - Global Industry Analysis 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 2NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 3
... of scientists from Washington State University has discovered how ... burglary-ring-like teamwork to infiltrate the human cell. ... infectious disease experts served as consultants in the filmmaking ... on a global Nipah outbreak. The WSU ...
... Ribbons of ultrathin graphene combined with polyurethane paint meant for ... according to scientists at Rice University. The Rice ... developed the compound to protect marine and airborne radars with ... The research was published this week in the ...
... have devised a novel way to boil water in less than ... yet been demonstrated in practice, could heat a small amount of ... a picosecond (a trillionth of a second). That is much less ... a second what one second is to almost 32 millennia. This ...
Cached Biology News:WSU scientists find burglary-ring-like mechanism in lethal 'Contagion' virus 2WSU scientists find burglary-ring-like mechanism in lethal 'Contagion' virus 3Graphene nanoribbons an ice-melting coat for radar 2Graphene nanoribbons an ice-melting coat for radar 3Ultrafast heating of water -- This pot boils faster than you can watch it 2Ultrafast heating of water -- This pot boils faster than you can watch it 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: