Navigation Links
Regado Biosciences, Inc. to Present at Aegis Capital Vegas Healthcare Conference
Date:9/25/2013

BASKING RIDGE, N.J., Sept. 25, 2013 /PRNewswire/ -- Regado Biosciences, Inc. (Nasdaq: RGDO), a biopharmaceutical company focused on the late-stage clinical development of its first-in-class, actively controllable antithrombotic drug system, REG1, today announced it will present at the Aegis Capital Vegas Healthcare Conference, to be held September 25 – 28, 2013, at the Encore at Wynn Las Vegas.

David J. Mazzo, Ph.D., President and Chief Executive Officer of Regado Biosciences, will provide an overview of the Company's business during his live presentation and will be available to participate in one-on-one meetings with investors who are registered to attend the conference.  Date: Friday, September 27, 2013 Time: 10:15 am (Pacific Time) Location:The Encore at Wynn Las Vegas; Las Vegas, NVABOUT REGADO BIOSCIENCES
Regado Biosciences, Inc. is a biopharmaceutical company focused on the development of novel, first-in-class, actively controllable antithrombotic drug systems for acute and sub-acute cardiovascular indications.  Regado is pioneering the development of two-component drug systems consisting of a therapeutic aptamer and its specific active control agent. The company's lead product candidate, REG1, is a two-component system consisting of pegnivacogin, an anticoagulant aptamer specifically targeting coagulation Factor IXa, and its complementary oligonucleotide active control agent, anivamersen.  REG1 is being developed for use in patients with a wide variety of acute coronary syndromes, or ACS, undergoing a percutaneous coronary intervention, or PCI, a hospital-based procedure used to mechanically open or widen obstructed coronary arteries. Regado's actively controllable product candidates have the potential to improve patient outcomes, enhance the patient experience and
'/>"/>

SOURCE Regado Biosciences, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Regado Biosciences, Inc. Announces Exercise of Over-Allotment Option
2. Regado Biosciences, Inc. Files Registration Statement for Proposed Initial Public Offering
3. Regado Biosciences, Inc. to Present at Needham & Companys 11th Annual Healthcare Conference in New York, NY
4. Regado Biosciences, Inc. to Present at the Cowen and Company 32nd Annual Health Care Conference in Boston, MA
5. SAGE Labs, Inc. Licenses CRISPR/Cas9 genome engineering technology from Caribou Biosciences, Inc.
6. Pressure BioSciences, Inc. to Discuss Second Quarter 2013 Financial Results and Provide a Business Update
7. Pressure BioSciences, Inc. Closes Final Tranche of Series J Above Market Private Placement - Total Amount Raised in PIPE Slightly Exceeds $2 Million Goal
8. Pressure BioSciences, Inc. to Discuss First Quarter 2013 Financial Results and Provide Business Update
9. Pressure BioSciences, Inc. Appoints Conrad F. Mir as Chief Financial Officer
10. Pressure BioSciences, Inc. Continues Global Sales Reach Expansion with Distribution Agreements for China, Vietnam, Laos, Cambodia, Australia, and New Zealand
11. Pressure BioSciences, Inc. Reaches Agreement with Investors on Initial $600,000 Tranche of $1.2 Million Above-Market Private Placement; Proceeds to Support Continued Commercialization of PCT Product Platform
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... San Diego, CA (PRWEB) December 18, 2014 ... announces a limited time special on Sartorius Biohit ... 1 Free on mLINE pipettes, Picus Electronic Pipette Trade-in ... recommended by Health and Safety officers around the world. ... repetitive manual pipetting. Other features include:, , ...
(Date:12/19/2014)... 18, 2014   ISN has released its ... Indicators publication series. With data aggregated from ... in 2013 within its online contractor management platform, ISNetworld, ... performance indicator (KPI) statistics. The ... publication is available in two industry specific volumes: ...
(Date:12/17/2014)... Based on the revenues gained ... market is dominated by four major players contributing ... These players include GE Healthcare (U.K.), Siemens AG ... , Full Report Copy at http://www.marketsandmarkets.com/Market-Reports/surgical-imaging-market-210534462.html ... be attributed to its strong product portfolio, which ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
Breaking Biology Technology:Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 2Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 3Global Refurbished Surgical Imaging Market by Product & Application is Estimated to Reach $1.25 Billion by 2019 - New Research Report by MarketsandMarkets 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8
... 2011 Verenium Corporation (Nasdaq: VRNM ), ... industrial enzyme solutions, today announced that James Levine, Executive ... the upcoming Piper Jaffray Sixth Annual Clean Technology & ... 3:00 p.m. EST on Wednesday, January 12, 2011 and ...
... , WEST LAFAYETTE, Ind. - Researchers are creating a ... natural photosynthetic systems in plants by using carbon nanotubes ... and reducing cost. "We,ve created artificial photosystems using ... to electrical power," said Jong Hyun Choi, an assistant ...
... and BUDAPEST, Hungary, Jan. 4, 2011 The IP ... property research and analysis solutions, and ChemAxon, the leader ... announced a strategic partnership whereby Thomson Reuters is providing ... patent data to users of ChemAxon,s JChem chemical software ...
Cached Biology Technology:Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 2Verenium to Present at Piper Jaffray Sixth Annual Clean Technology & Renewables Conference 3New solar cell self-repairs like natural plant systems 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 2Thomson Reuters and ChemAxon Partner to Help Speed Drug Discovery for Life Science Researchers 3
(Date:12/11/2014)... , Dec. 09, 2014 Research and Markets ... ( http://www.researchandmarkets.com/research/9ql3kr/biometrics_market ) has announced ... India 2015-2019" report to their offering. ... market is the adoption of multimodal biometric systems. ... of an individual for verification and identification purposes. ...
(Date:12/10/2014)... 2014  Wake Forest Baptist Medical Center today announced plans ... of Medicine. Funding for this $50 million capital project ... be publicly launched next summer. The ... 60 series R.J. Reynolds Tobacco Company complex, adjacent to ... immediately with plans to be ready to welcome medical ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
Breaking Biology News(10 mins):Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... a soil science professor at the University of Guam, has ... use in shielding the reefs in Pago Bay from the ... major health hazards facing Guam,s reefs is soil erosion resulting ... up a reef system. "Vetiver,s ability to tolerate high stress ...
... fog, tennis shoes, chocolate mousse, and proteins have something in ... of research that explains the behavior of a wide variety ... and a number of biological materials. In the ... made of (Springer), Roberto Piazza, professor of condensed matter physics, ...
... in their personal and professional lives, University of ... gain greater control over their thoughts with real-time ... first investigation of how real-time functional Magnetic Resonance ... for higher-order thoughts, including introspection, affects our ability ...
Cached Biology News:Bioengineering with vetiver grass on Guam 2Soft matter -- the stuff that dreams are made of 2People control thoughts better when they see their brain activity: UBC study 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: