Navigation Links
Recognized Dermatology Expert Dr. Zoe Draelos Joins Histogen Scientific Advisory Board
Date:11/13/2008

nd anti-aging in early 2009, and continue development of additional skin, hair, and nail care products in the aesthetic medicine arena."

Dr. Draelos has served as Principal Investigator on more than 200 clinical trials, is a national and international speaker, and has been the recipient of numerous research grants. She is also a significant contributor to medical literature, with more than 200 articles and 25 book chapters to her credit. She is the author of the text Cosmetics in Dermatology, now in its third edition, and Hair Care, as well as serving as the editor for the textbook Cosmeceuticals, which has been translated into 5 languages.

Complementing her writing endeavors, Dr. Draelos serves on 8 editorial boards, including Cosmetic Dermatology, The International Journal of Cosmetic Science, Dermatologic Surgery, and Dermatology Times. She also serves as editor-in-chief of the Journal of Cosmetic Dermatology.

Dr. Draelos is a fellow and past board member of the American Academy of Dermatology and a member of the American Dermatological Association, the Society for Investigative Dermatology, the American Society of Mechanical Engineers, among others. A former Rhodes Scholar, Dr. Draelos has been the recipient of many awards and honors in recognition of her professional and academic accomplishments. She was recently given a Lifetime Achievement Award for her research from Health Beauty America, a professional skin care and cosmetics industry organization.

"The rapid development of the sub-specialty of cosmetic dermatology, with a growing focus on basic and clinical research into all aspects of cosmetic medicine, requires new technological advances to address the complexities for this growing area of medicine," commented Draelos. "Histogen scientists have developed a technology that may address many future clinical challenges of aesthetic medicine."

Histogen Aesthetics LLC, established in 2008
'/>"/>

Source: PRWeb
Copyright©2008 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Unique New Initiative by World-Recognized Specialists in Heart Disease and Diabetes to Reduce Residual Vascular Risk Launched Today
2. Two Metabolex Projects Recognized in Windhovers Top 10 Lists for Partnering Opportunities
3. BioTrends Research Group, Inc. Recognized as One of Philadelphias Fastest Growing Privately Held Companies
4. Global Vision Recognized for Helping Pharmaceutical Companies Achieve Complete Artwork and Copy Accuracy in their Packaging Process
5. Lilly Recognized as One of the Worlds Top Biopharmaceutical Employers
6. Monsanto Recognized as Top Biotechnology Employer by Science Magazine
7. Titan Spine Teams Up With Syndicom, Inc. to Utilize Internationally Recognized SpineConnect Collaboration Platform
8. Quintiles Recognized Among Best Companies to Work For in Brazil
9. MedNet Solutions Again Recognized as one of the Fastest Growing US Companies
10. Ohio Recognized as National Leader for Business Development and Job Creation
11. Kiwa Bio-Tech Receives Nationally Recognized Organic Products Certification
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/20/2014)... OR (PRWEB) October 20, 2014 Local ... participate in an investigational study of donor stem cells ... in stem cell therapy and has performed clinical stem ... this study is to determine if a single injection ... affected joints can help reduce pain and inflammation in ...
(Date:10/19/2014)... NextCODE Health, which enables clinicians and researchers to use full ... the launch of its new genomic data analysis and collaboration ... of Human Genetics (ASHG) annual meeting in San ... for free beta access, visit www.nextcode.com . A brief ... here . The Exchange: , ...
(Date:10/19/2014)... The Asia-Pacific Speech Analytics market report defines and ... and forecast of revenue. This market is estimated to ... by 2019, at a Compound Annual Growth Rate (CAGR) ... the TOC of the Asia-Pacific Speech Analytics market report ... It also provides a glimpse of the segmentation in ...
(Date:10/19/2014)... The report "Unmanned Ground Vehicle Market by Application ... & by Geography - Forecasts & Analysis 2014–2020", ... market into various sub segments with an in-depth ... also identifies the factors driving this market, various ... adoption trends. , The unmanned ground vehicle market ...
Breaking Biology Technology:Cascade Veterinary Referral Center Seeks Candidates for an Investigational Study of Stem Cells for Dogs with Arthritis 2The NextCODE Exchange: The first global, real-time system for sharing full-resolution genomic data 2The NextCODE Exchange: The first global, real-time system for sharing full-resolution genomic data 3The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 2The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 3The Asia-Pacific Speech Analytics market is estimated to reach $208 million by 2019 - New Report by MicroMarket Monitor 4Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 2Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 3Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 4Unmanned Ground Vehicle (UGV) Market Estimated to Reach $8.26 Billion by 2020 - New Research Report by MarketsandMarkets 5
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: