Navigation Links
Recent Graduates Finding BioTech & Pharmaceutical Jobs Easier Than Ever With The Launch of CampusRXBio
Date:3/30/2009

arch jobs, but thousands of positions in non-technical roles like marketing, sales, accounting finance, and human resources" says CEO & Founder, Matt Casey. "Many job seekers come from a scientific background with degrees in fields like chemistry or biology , but others are simply recent grads looking to become involved in these exciting new industries."

Even with the slumping economy, the life sciences industries don't show any sign of slowing down. The U.S. Department of Labor and Statistics reports that the biotechnology and pharmaceutical industries rank among the fastest growing industries in the United States. According to the Bureau of Labor Statistics, job growth through 2014 for these industries overall (and for numerous select occupations ranging from scientific positions to sales to office/administrative roles) is expected to far exceed the average growth for all industries combined.

Recent Graduates are in demand as new biotech jobs and pharmaceutical jobs are posted everyday. That's why CampusCareerCenter has responded to meet job seekers' needs by launching CampusRXBio,

"Students, new graduates and alumni want employment and networking resources that are geared to their specific job market rather than only part of a general mega site. We have experienced this first-hand with the incredible popularity of our nursing/healthcare specific site, CampusRN. Now we are excited to launch CampusRXBio to meet the needs of candidates exploring careers in the fast-growing biotechnology, pharmaceutical and life science fields." added Casey.

About CampusRXBio:
CampusRXBio is a subsidiary of CampusCareerCenter.com. Campu
'/>"/>

Source: PRWeb
Copyright©2009 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. New Discoveries on a Fingertip Test for Screening Silent Heart Disease Promising Results of Recent Clinical Studies to be Presented during the 2009 American College of Cardiology Conference, March 29th - April 1st in Orlando
2. Oppenheimer Announces the Addition of Several Recent Senior Hires in Investment Banking
3. Recent Reports Regarding Mercury and High Fructose Corn Syrup Flawed and Misleading
4. Recent Advances in Organic Chemistry Using Real-Time In Situ FTIR
5. American Oriental Bioengineering Comments on Recent Property Purchase
6. Bionovo to Present Recent Findings of BN107, its Anticancer Agent, at the 31st Annual San Antonio Breast Cancer Symposium
7. New Report Provides Expert Analysis of Recent Advances and Setbacks in Parkinsons Disease Drug Development
8. TorreyPines Therapeutics Reports Third Quarter 2008 Results and Recent Accomplishments
9. Nventa Biopharmaceuticals Announces Third Quarter 2008 Financial Results and Recent Corporate Highlights
10. [video] Wall St. Networks 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO
11. [video] Wall St. Networks 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: IMMU, KYUS
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: