Navigation Links
PolyTherics and Antitope Combine to Create Leading Provider of Solutions to Enable the Development of Better Biopharmaceuticals
Date:7/26/2013

LONDON and CAMBRIDGE, England, July 26, 2013 /PRNewswire/ --

PolyTherics receives new investment to accelerate growth

PolyTherics Limited ("PolyTherics") announces that it has merged with Antitope Limited ("Antitope"), the leading provider of antibody engineering and immunogenicity screening services, to create an enlarged group with an extensive suite of services and technologies to enable the development of better biopharmaceuticals.

PolyTherics is issuing new shares up to an aggregate value of £13.5 million to fund the merger with Antitope and to provide working capital for the enlarged group. Imperial Innovations (AIM: IVO) led the investment and brought in new investor Invesco Perpetual with further funds provided by Mercia Fund Management and Advantage Enterprise & Innovation Fund.

The enlarged PolyTherics group will leverage its combined portfolio of proprietary and complementary technologies and services to address key needs in biopharmaceutical development. The combined portfolio will include conjugation technologies to produce more stable and homogeneous antibody drug conjugates, technologies to optimise the pharmacokinetics of biologics, technologies for immunogenicity screening, technologies to re-engineer antibodies and proteins to reduce their immunogenicity, and cell line development technologies. The group has a strong client base in the biotechnology and pharmaceutical industry, including many of the world's top companies.

Dr John Burt will continue as CEO of PolyTherics and Antitope will operate as a wholly owned subsidiary of the PolyTherics group. Dr Matthew Baker will continue as Chief Scientific Officer for Antitope and the company will retain its base, management and operational structure at the Babraham Research Campus, near Cambridge.    

The ex
'/>"/>

SOURCE PolyTherics
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Shimadzu's New MALDI-7090 TOF-TOF Mass Spectrometer Combines High Throughput, High Resolution and High Energy for the Ultimate in Tandem MS Capabilities
2. FTI Consulting Releases Realigned Segment Information Reflecting Newly Combined Health Solutions Practice
3. Fantastic flash memory combines graphene and molybdenite
4. Motus Brings a Whole New Dimension to the NFL Combine Training Program at IMG Academy
5. New Informatics and Bioimaging Center combines resources, expertise from UMD, UMB
6. GDS International Combines Top Healthcare Executives in the United States for its 10th Anniversary NG Healthcare Summit in May
7. QIAGEN Partners with Exosome Diagnostics to Create High-Performance Biofluid Sample Preparation Kits for Personalized Healthcare Research
8. NYSCF scientists create personalized bone substitutes from skin cells
9. American Management Association Teams With Biogen Idec To Create Life Skills Workshops For People Living With Hemophilia
10. Data Spectacles Create Rosy Tint
11. Leading Biotoxin & Mold Illness Authority Creates Certification Process for Treatment Protocol
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: