Navigation Links
Par Pharmaceutical Reports Second Quarter 2008 Results

competition on the Company's generic products, decreased net sales of Megace(R) ES, and lower royalty income.

Revenues for the generic products division during the three month period decreased 36.4% to $92.9 million compared with the same period in 2007 due to competitive pressure, including for fluticasone, ranitidine HCl syrup, cabergoline, and a decline in many of the Company's other products due to pricing pressures as well as lower royalties driven from ondansetron ODT. Partially offsetting the decreases were increased sales of metoprolol resulting from the launch of additional strengths in the third quarter of 2007 and various amoxicillin products. Second quarter 2008 revenue for Strativa decreased to $20.0 million from $21.6 million in the prior year due to decreased net sales of Megace(R) ES.

Par's second quarter gross margin was 22.2% of sales, compared with 33.7% in 2007. This decrease is primarily attributed to increased sales of lower margin metoprolol, lower royalty income, lower sales of higher margin products such as propranolol, and a decline in many of the Company's other generic products due to pricing pressures, tempered by higher relative sales of Megace(R) ES. The gross margin rate for Strativa was 79.3% in the second quarter of 2008 compared with 72.5% in the same period in 2007.

Research and development (R&D) expense increased $1.7 million or 11.8% to $16.0 million in the second quarter of 2008, driven primarily by an increase in on-going development costs associated with the expansion of Par's generic portfolio and includes Strativa's research costs related to the development of Zensana(TM) and an initial payment related to the in-licensing agreement with MonoSol Rx.

Second quarter selling, general and administrative (SG&A) expense increased 7.9% to $36.7 million compared with the second quarter of 2007. The increase was driven by legal fees related to ongoing litigation, including Paragraph IV litigation costs. Th

SOURCE Par Pharmaceutical Companies, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8

Related biology technology :

1. Keryx Biopharmaceuticals, Inc. to Hold Conference Call on Second Quarter 2008 Financial Results on Monday, August 11, at 8:30 A.M. EDT
2. Memory Pharmaceuticals to Announce Second Quarter 2008 Results on Wednesday, August 13, 2008
3. Watson Pharmaceuticals Reports Second Quarter 2008 Results
4. XTELL Launches its Commercial Biorepository Services for Research and Pharmaceutical Companies
5. Onyx Pharmaceuticals Reports Second Quarter and Six-Month 2008 Financial Results
6. Arena Pharmaceuticals Announces Second Quarter 2008 Financial Results and Recent and Second Quarter Highlights
7. Marinus Pharmaceuticals Appoints John Krayacich as President and Chief Executive Officer
8. Prometic reaches understanding for commercialisation of several biopharmaceutical products and strategic investment
9. Cadence Pharmaceuticals CEO Theodore Schroeder to Present at Two Investment Conferences During the Month of August 2008
10. Kowa Company, Ltd. Acquires ProEthic Pharmaceuticals, Inc.
11. Lilly Reaffirms Purchase Offer for SGX Pharmaceuticals
Post Your Comments:
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: