Navigation Links
PAREXEL Data Indicate U.S. Marketing Applications for New Molecular Entities Bounce Back
Date:8/25/2008

NDA

-- Analysis of drug review times, performance trends, and success rates by therapeutic category, as well as standard versus priority classification

-- The impact of accelerated approval, orphan drug status, and related programs on review times and outcomes

-- Data regarding other key new drug submissions, including NDA resubmissions, efficacy supplements, and manufacturing supplements

PAREXEL's newly-released The US Drug Approval Trends and Yearbook 2008/2009 is the largest compendium of drug approval trends and metrics ever compiled. To order the compendium ($295 USD), visit http://www.barnettinternational.com/EducationalServices/ or email customerservice@barnettinternational.com. For more PAREXEL book titles published and distributed by Barnett International, a division of Cambridge Healthtech Institute (CHI), visit Barnett Educational Services at http://www.barnettinternational.com/.

About PAREXEL International

PAREXEL International Corporation is a leading global biopharmaceutical services organization, providing a broad range of knowledge-based contract research, medical communications and consulting services to the worldwide pharmaceutical, biotechnology and medical device industries. Committed to providing solutions that expedite time-to-market and peak-market penetration, PAREXEL has developed significant expertise across the development and commercialization continuum, from drug development and regulatory consulting to clinical pharmacology, clinical trials management, medical education and reimbursement. Perceptive Informatics, Inc., a subsidiary of PAREXEL, provides advanced technology solutions, including medical imaging, to facilitate the clinical development process. Headquartered near Boston, Massachusetts, PAREXEL operates in 69 locations throughout 52 count
'/>"/>

SOURCE PAREXEL International Corporation
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. PAREXEL International to Present at Thomas Weisel Partners Healthcare Conference
2. Parexel Consulting Strengthens Good Manufacturing Practice Capabilities in Europe
3. PAREXEL International Completes Acquisition of APEX International Clinical Research Co., Ltd.
4. PAREXEL International Updates Financial Guidance in Conjunction with the Acquisition of APEX International Clinical Research Co., Ltd. and Other Factors
5. PAREXEL Announces Date of First Quarter Fiscal Year 2008 Earnings Release and Conference Call
6. PAREXEL Reports First Quarter Fiscal Year 2008 Financial Results
7. PAREXEL Appoints Charles A. Stevens as Vice President/General Manager of Health Policy and Strategic Reimbursement and Strengthens Capabilities
8. PAREXEL Announces Date of Second Quarter Fiscal Year 2008 Earnings Release and Conference Call
9. PAREXEL Names Biopharmaceutical Industry Executive Eduard E. Holdener to Board of Directors
10. PAREXEL Reports Second Quarter Fiscal Year 2008 Financial Results
11. PAREXEL International Announces 2-For-1 Stock Split
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: