Navigation Links
Oral Drug From Novartis/Mitsubishi Tanabe Will Capture the Largest Market Share of All Emerging Multiple Sclerosis Therapies in 2017
Date:5/29/2008

Overall Market Growth Will be Driven by Launch of Nine Emerging Therapies,

Including Five Oral Agents, According to a New Report from Decision

Resources

WALTHAM, Mass., May 29 /PRNewswire/ -- Decision Resources, one of the world's leading research and advisory firms for pharmaceutical and healthcare issues, finds that the highly anticipated launch of the first oral agents formally approved for multiple sclerosis will drive market growth as these therapies, combined, will garner 25 percent market share in 2017.

The new Pharmacor report entitled Multiple Sclerosis estimates that Novartis/Mitsubishi Tanabe's oral agent, FTY-720 (fingolimod) will capture nearly $900 million by 2017 in the United States, France, Germany, Italy, Spain, United Kingdom and Japan, representing the greatest market share of any emerging multiple sclerosis therapy over the next decade. The report finds that, despite limited patient share, sales of FTY-720 will be driven by its improved efficacy, acceptable safety profile, and added convenience. The launch of nine emerging therapies-including five oral drugs-will drive moderate four percent annual growth through 2017 in the multiple sclerosis drug market. Rapid uptake of premium-priced oral drugs and the growing use of monoclonal antibodies, particularly in the United States, will spark this growth.

The report also finds that other strong contenders in the multiple sclerosis market over the next 10 years will include Merck Serono's oral cladribine (Mylinax), BioMS Medical/Eli Lilly's MBP-8298, and alemtuzumab, which is marketed in the U.S. as Campath for B-cell chronic lymphocytic leukemia by Bayer HealthCare and Genzyme Oncology. Oral cladribine's first-to- market status among emerging oral agents, MBP-8298's approval for secondary progressive multiple sclerosis and alemtuzumab's impressive efficacy will drive major-market peak-year sales for each drug to the range of $500 millio
'/>"/>

SOURCE Decision Resources
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Biological electron transfer captured in real time
2. AbelsonTaylor Captures DTC Gold
3. Safety Profile of TAXUS(R) Liberte(TM) Stent System Highlighted in Worlds Largest Stent Registry
4. Largest Asian Cancer Hospital to Evaluate New CT Laser Breast Imaging System
5. Researchers outline structure of largest nonvirus particle ever crystallized
6. Medco Chooses AllPoints at Anson in Whitestown, Indiana as Site for the Worlds Largest, Most-Advanced Automated Pharmacy
7. The LANCET Published ENDORSE, the Largest Multinational Study Showing That the Majority of Hospitalized Patients Surveyed are at Risk for VTE and Many do not Receive Recommended VTE Prophylaxis
8. Thoratec Reports 10 Percent Increase in Fiscal 2007 Revenues; Fourth Quarter Revenues Largest in Company History
9. ChanTest to Highlight Expanded Ion Channel Testing Services for Preclinical Safety at ToxExpo, Including the Worlds Largest Catalog of Validated Ion Channels, Booth 2504
10. Susan G. Komen for the Cure(R) Announces Largest Grants Slate Ever: $100 Million to Speed Delivery of Breast Cancer Discoveries, Cures
11. Cepheid Signs Group Purchasing Contract with Novation, the Nations Largest Healthcare Contracting Organization
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: