Navigation Links
Operon Biotechnologies and DNA2.0 Announce Co-Marketing and Technology Development Partnership
Date:8/22/2007

http://www.DNA20.com.

About Operon Biotechnologies

Operon Biotechnologies is a global market leader in high-throughput synthesis, serving scientists in academic research, biotechnology, and pharmaceutical development. Through our production facilities in the US, Germany, and Japan, as well as distributors worldwide, Operon provides a wide range of quality DNA oligonucleotides, Array Ready Oligo Sets (AROS(TM)) and pre-printed microarrays (OpArray(TM)). Since its inception in 1986, Operon has been driven by incomparable customer service and reliable delivery of quality products. Operon employs advanced synthesis technologies and consistently pursues unique innovations to maintain the highest level of excellence in both products and support. For more information please visit http://www.operon.com.


'/>"/>
SOURCE Operon Biotechnologies
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Speaker announces business members of IT Task Force
2. Doyle announces technology tax credits for Berbee
3. Doyle announces new energy, global warming policies
4. Doyle, WARF announce partnership to lure stem cell companies
5. Doyle announces $80M renewable energy strategy
6. GE announces first installation of Discovery VCT
7. UWM announces winners of RGI awards
8. Third Wave announces two senior management appointments
9. Mirus announces new method for making antibodies
10. Merge announces sofware updates, upcoming acquisition
11. Small Tree announces ethernet solution for Apple Xserv G5
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... /PRNewswire-FirstCall/ - MIGENIX Inc.,(TSX: MGI; OTC: MGIFF), ... reports financial results for the three months ... its programs., UPDATE ON DRUG DEVELOPMENT ... cationic peptide;,prevention of catheter-related infections): A pivotal ...
... a Planned Phase II Study of ... Sclerosis, COPENHAGEN, Denmark, December 13 Genmab A/S,(OMX: ... study of,ofatumumab (HuMax-CD20(R)) for the treatment of relapsing remitting,multiple ... study which will be conducted under Genmab,s collaboration with,GlaxoSmithKline ...
... SAN FRANCISCO, Calif., Dec. 13 Anesiva,Inc. (Nasdaq: ... a common stock offering,of 11,111,111 shares of its ... discount to the closing bid price on December ... before deducting underwriting,discounts and commissions (approximately $50 million ...
Cached Biology Technology:MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 2MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 3MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 4MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 5MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 6MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 7MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 8MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 9MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 10MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 11MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 12MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 13MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 14MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 15MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 16MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 17MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 18Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 2Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 3Anesiva Raises $45 Million in Common Stock Offering 2
(Date:11/6/2014)... 6, 2014 - Insilico Medicine, Inc, a Baltimore-based ... age related diseases announced a research collaboration with ... Champions Oncology, Inc (OTC: CSBR). , "There are ... medicine, but Champions Oncology,s TumorGraft technology is unique ... chemotherapy regimen experimentally generating vast amounts of valuable ...
(Date:11/5/2014)... Kelly Redmond has dedicated his career to understanding ... a general audience. , As deputy director and ... at Nevada,s Desert Research Institute, Redmond has more ... application and dissemination of climate data to the ... Meeting in San Francisco on December 15-19, 2014 ...
(Date:11/4/2014)... LAKE CITY, Nov. 5, 2014 – University of Utah ... enzymes to help jet fuel produce electricity without needing ... be used to power portable electronics, off-grid power and ... online today in the American Chemical Society journal ... electricity through a chemical reaction between a fuel and ...
Breaking Biology News(10 mins):Insilico Medicine, Inc announces research collaboration with Champions Oncology, Inc 2Nevada climatologist to be honored at AGU Fall Meeting for lifetime of public outreach 2Jet-fueled electricity at room temperature 2
... for the first time, how a potted plant,s roots are arranged ... be presented at the Society for Experimental Biology meeting on 30th ... makes plants grow over 40% larger. From their 3-D ... their roots to the pot,s walls. It is likely that the ...
... new batch of Geology papers posted online ... asynchrony; oceanic crust; sand budgets; the Alpine fault,s seismic ... weathering in the Critical Zone; giant wave ripples; the ... network; and soils as ledgers recording transactions of energy ...
... apart DNA that bears certain signature sequences is a defense ... can be a powerful research tool. With a newly discovered ... a targeted method of slicing DNA that they say can ... lab. Tools that snip apart DNA strands in defined ...
Cached Biology News:Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 2Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 3Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 4Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 5Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 6Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 7Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 8Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 9Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 10Programmable RNA complex could speed genome editing in the lab 2Programmable RNA complex could speed genome editing in the lab 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: