Navigation Links
OpenClinica EDC Solution Deployed for Retina Implant Studies
Date:8/20/2008

German medical device company, Retina Implant, AG has selected OpenClinica as its electronic data capture (EDC) and clinical data management (CDM) system to power its clinical trials.

Ruetlingen, Germany (PRWEB) August 20, 2008 -- German medical device company, Retina Implant, AG has selected OpenClinica as its http://www.openclinica.org/section.php?sid=1 [electronic data capture (EDC) __title__ EDC software] and clinical data management (CDM) system to power its clinical trials. The company's primary product is a novel retinal prosthesis that in many ways is analogous to the popular cochlear implant used as a hearing prosthesis. The device will primarily be used to treat Retinitis Pigmentosa (RP) and Age-related Macular Degeneration (AMD).

"We are currently using OpenClinica for 11 trials with sites in Germany, India, and Brazil, and we plan to use it for new studies with sites in the U.S. as well," said Anusch Hekmat, VP of Quality Management & Regulatory Affairs at Retina Implant. "As a small medical device company, the professional open source approach behind OpenClinica makes a lot of sense. It allows us to be highly adaptable in how we administer our clinical trials while providing us with high quality professional support in key areas."

Selecting, implementing, and supporting a sound, regulatory compliant system for clinical trial data management can be challenging for smaller biotech companies. Retina Implant is among numerous other biotech and pharmaceutical companies who enjoy the flexibility and compelling value of a professionally supported open source solution.

"OpenClinica removes many of the constraints that proprietary vendors tend to put on their clients," said Ben Baumann, Director of Business Development at Akaza Research, the creators o
'/>"/>

Source: PRWeb
Copyright©2008 Vocus, Inc.
All rights reserved  

Page: 1 2 3

Related biology technology :

1. RF Technologies(R) Installs Safe Place(R) Solution for Pediatric and Infant Security at ProHealth Cares Waukesha Memorial Hospital
2. Cascade Controls Changes Corporate Identity to Cascade Solutions
3. Aureus Pharma Releases AurPROFILER(R) - a New and Powerful Pharmacology Profiling Solution
4. BioInformatics, LLC Offers Solutions for Optimizing Service and/or Maintenance Contracts
5. StollerUSA Launches Bio-Forge.com to Offer Solutions for Crops Under Stress
6. PerkinElmer Expertise and Solutions Integral to Food Safety Monitoring for the Beijing Games : Methods, Applications Expertise and Instrumentation Deployed in Mobile Laboratory
7. TriMix Laboratories Announces New Partnership With American Pharmacy Solutions
8. NanoLogix Inc. Announces Joint Development With CL Solutions and First Sales of Rapid Detection Kits
9. Protein Sciences Announces Termination of Deal to Sell to Emergent BioSolutions
10. Advanced Bionics Reaches Resolution With FDA, Settles Financial Suit
11. Super-resolution X-ray microscopy
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
OpenClinica EDC Solution Deployed for Retina Implant Studies
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: