Navigation Links
Ohr Pharmaceutical Appoints Thomas M. Riedhammer To Board Of Directors
Date:5/2/2013

NEW YORK, May 2, 2013 /PRNewswire/ -- Ohr Pharmaceutical Inc. (OTCQB: OHRP), a pharmaceutical company focused on the development of novel therapeutics for unmet medical needs, today announced the appointment of Thomas M. Riedhammer , Ph.D., to its Board of Directors. Dr. Riedhammer has over 35 years of ophthalmic industry experience, working for large and small pharmaceutical companies engaged in drug development through commercialization.

"We are pleased to have brought on someone of Dr. Riedhammer's caliber," stated Dr. Irach Taraporewala, CEO of Ohr. "Tom's proven expertise in building successful companies in the ophthalmic pharmaceutical industry will be an immeasurable asset to Ohr at this important juncture in the company's growth."

"I am excited to join the team at Ohr Pharmaceutical," commented Dr. Riedhammer. "Squalamine eye drops are a unique and potentially transformative product for wet-AMD patients, a large patient population currently being treated with chronic intravitreal injections directly into the eye. I look forward to contributing to the future growth of Ohr and providing benefit for patients in need."

Ira Greenstein , Chairman of the Board of Directors, added, "With our recent financing providing us with sufficient capital until 2015, anticipated enrollment milestones and a potential listing on Nasdaq on the horizon, it is a great time to welcome Dr. Riedhammer, with his wealth of experience in the development of ophthalmic companies, onto the team at Ohr."

Dr. Riedhammer has over 35 years of ophthalmic industry expertise.  Most recently, Dr. Riedhammer was Chairman of Sirion Therapeutics, where he was instrumental in raising over $100 million dollars of private equity and the subsequent FDA approval and launch of two ophthalmic products in the U.S. Prior to Sirion, Dr. Riedhammer served as the Chief Operating Officer
'/>"/>

SOURCE Ohr Pharmaceutical Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. ISPE End-to-End Supply Chain Conference - Stepping up Pharmaceutical Operations
2. Sterilization Market (Medical Devices, Pharmaceutical, Healthcare, Food Applications), Equipments & Contract Services - Global Forecast To 2017
3. White Mountain Process Announces Sanitary Autoclave Style Pharmaceutical Agitator
4. Valeant Pharmaceuticals Announces Extension of the Expiration Date for Its Previously Announced Tender Offer for All Outstanding Shares of Common Stock of Obagi Medical Products, Inc.
5. VentiRx Pharmaceuticals Appoints James Kyle Bryan, M.D. as Chief Medical Officer
6. Aurigenes Collaboration Programs with Endo Pharmaceuticals Reach Important Milestones
7. Ohr Pharmaceutical Announces $5 Million Financing from Exercise of Warrants
8. DSM announces June opening of new cGMP biopharmaceutical manufacturing operation in Brisbane, Australia
9. Shimadzu's New DSC-60 Plus Series Differential Scanning Calorimeters Offer High-Sensitivity Analysis in Polymer, Food and Pharmaceutical Applications
10. Vanda Pharmaceuticals Appoints Dr. Paolo Baroldi As Chief Medical Officer
11. PharmaDirections Celebrates 10 Years of Success for Their Virtual Biotech and Pharmaceutical Clients
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: