Navigation Links
Nventa updates progress of cervical dysplasia trial with new HspE7
Date:10/18/2007

release are cautioned that such statements or information are only predictions, and that the Company's actual future results or performance may be materially different.

Forward-looking statements or information in this press release include, but are not limited to, statements or information concerning: the number of cohorts and patients and the expected dosing amounts in the Phase 1 trial; successful completion of the Phase 1 trial; the launching of a Phase 2 clinical trial in patients with high-grade cervical intraepithelial neoplasia (CIN2/3); the possibility of a second Phase 2 trial in HIV-positive low-grade CIN patients.

Such forward-looking statements or information involve known and unknown risks, uncertainties and other factors that may cause our actual results, events or developments to be materially different from results, events or developments expressed or implied by such forward-looking statements or information. Such factors include, among others, the possibility that we will not be able to recruit patients for our trials in a timely manner; our need for capital, risks associated with requirements for approvals by government agencies such as the FDA before products can be tested in clinical trials; the possibility that such government agency approvals will not be obtained in a timely manner or at all or will be conditioned in a manner that would impair our ability to advance development; risks associated with the requirement that a drug be found safe and effective after extensive clinical trials: our dependence on suppliers, collaborative partners and other third parties and the prospects and timing for negotiating supply agreements, corporate collaborations or licensing arrangements; our ability to attract and retain key personnel; and other factors as described in detail in our filings with the Canadian securities regulatory authorities at http://www.sedar.com.

Assumptions underlying
'/>"/>

SOURCE Nventa Biopharmaceuticals Corporation
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Merge announces sofware updates, upcoming acquisition
2. Tech Digest: Merge eMed product updates; Renaissance Learning 3rd qtr results
3. Solinus updates MailFoundry anti-spam hardware, switching to Linux
4. Wingra Technologies updates data migration software
5. Wisconsin cities make progress on wireless Internet coverage
6. Doyle laments lack of progress on stem cell bill
7. U.S. health system could undermine EHR progress
8. Stem-cell controversies slow progress
9. VC trends, company progress discussed at Mason Wells portfolio meeting
10. Can you keep ahead of progress? An exclusive interview with Rick Smith of iNoc
11. Furious pace of Midwest biotech events marks progress
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... -- N. BILLERICA, Mass., Sept. 20 ... ... ... are keyed by longUrl, so we need to grab the first one. for (var r in data.results) ...
... Mass., Sept. 20 Caliper Life Sciences, Inc. (Nasdaq: ... President and CEO of Caliper will be providing a ... Basel, Switzerland. This invited presentation, entitled "Next Generation Tools ... and will highlight key trends that are transforming "sick ...
... (NYSE Amex: NBS ) ("NeoStem" or the "Company"), ... China, announced today that its CEO, Dr. Robin Smith, is ... the FOX Business Network.   The show,s first ... will air each upcoming Saturday at 1:30 p.m. Eastern Time ...
Cached Biology Technology:Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 2Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 3Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 4Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 5Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 6Caliper Life Sciences CEO to Present Keynote Presentation at MipTec European Conference 2FOX Business Network Airing In-Depth Look at NeoStem 2FOX Business Network Airing In-Depth Look at NeoStem 3
(Date:6/25/2015)... , June 25, 2015  Imagine a tool ... toward a healthier, happier life. That,s exactly what USANA,s ... to do. The cutting-edge, portable health program provides a ... solutions to help improve your lifestyle and nutrition. ... dinner and gala Wednesday night, USANA,s THA was honored ...
(Date:6/24/2015)... Research and Markets( ... "Huawei Ascend Mate 7 Fingerprint Sensor - ... Huawei,s technological choice for the fingerprint ... Apple,s and Samsung,s one. The Ascend Mate 7 ... Cards, a main actor in capacitive sensing human ...
(Date:6/23/2015)... June 23, 2015  Crossmatch™, a leading ... today announced enhanced functionality of its DigitalPersona ... The enhancements build on the native flexibility ... Altus platform and provide expanded mobile credential ... In today,s environment of increasing cyber-attacks and ...
Breaking Biology News(10 mins):@USANAinc's Personalized Nutrition Program Wins Industry Innovation Award 2Huawei Ascend Mate 7 Fingerprint Sensor - Reverse Costing Analysis 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2
... vision has been inspiring debate across the scientific community ... to the wider discussion about open access publishing has ... publication of its first few articles (please see ... issued and further articles will be published on the ...
... but few studies of lung nodule identification and clinical ... Kaiser Permanente Southern California identified 7,112 patients who had ... the electronic medical record. Their study presented ... for the Study of Lung Cancer,s (IASLC) Journal ...
... notorious for secreting chemicals that confuse the immune system ... some cancer treatments try to neutralize the cancer,s chemical ... do both at the same time are rarely successful. ... simultaneously deliver a sustained dose of both an immune-system ...
Cached Biology News:First articles now live on F1000 Research 2First articles now live on F1000 Research 3Elegant delivery 2Elegant delivery 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: