Navigation Links
Nuvelo Shareholders Approve Issuance of Common Stock Pursuant to Merger Agreement With ARCA biopharma
Date:1/7/2009

action. Investors and security holders may obtain free copies of these documents and other documents filed with the SEC at the SEC's website at http://www.sec.gov. In addition, investors and security holders may obtain free copies of the documents filed with the SEC by contacting Nuvelo Investor Relations at the email address: ir@nuvelo.com or by phone at 650-517-8000.

In addition to the registration statement and related proxy statement/prospectus/consent solicitation, Nuvelo files annual, quarterly and special reports, proxy statements and other information with the SEC. You may read and copy any reports, statements or other information filed by Nuvelo, Inc. at the SEC public reference room at 100 F Street, N.E., Washington, D.C. 20549. Please call the SEC at 1-800-SEC-0330 for more information. Please call the SEC at 1-800-SEC-0330 for further information on the public reference room. Nuvelo, Inc.'s filings with the SEC are also available to the public from commercial document-retrieval services and at SEC's website at http://www.sec.gov, and from Investor Relations at Nuvelo as described above.

This communication shall not constitute an offer to sell or the solicitation of an offer to sell or the solicitation of an offer to buy any securities, nor shall there be any sale of securities in any jurisdiction in which such offer, solicitation or sale would be unlawful prior to registration or qualification under the securities laws of any such jurisdiction. No offering of securities shall be made except by means of a prospectus meeting the requirements of Section 10 of the Securities Act of 1933, as amended.

Nuvelo, ARCA and their respective directors and executive officers may be deemed to be partic
'/>"/>

SOURCE Nuvelo, Inc.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Nuvelo Reports First Quarter 2008 Financial Results and Updated Outlook for 2008
2. Nuvelo Reports Second Quarter 2008 Financial Results
3. Nuvelo Initiates Phase 1 Clinical Trial of NU206 in Healthy Volunteers
4. Nuvelo and ARCA biopharma Announce Merger Agreement Creating Late-Stage Cardiovascular Biotechnology Company
5. Nuvelo and ARCA biopharma Advance Toward Completion of Merger
6. Nuvelo Announces Positive Results from Phase 1 Clinical Trial of NU206 in Healthy Volunteers
7. Spherix Shareholders Support Companys Focus on Naturlose, Biotechnology
8. Healthcare Technologies Calls for a Shareholders Meeting to Approve the Nexgen Biofuels Transaction
9. Annual General Meeting ("AGM") and Extraordinary General Meeting ("EGM") Notices Posted to Shareholders
10. Rosetta Genomics Announces Annual General Meeting of Shareholders to be Held on September 24, 2007
11. Pharmos Issues Letter to Shareholders
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:4/24/2015)... Texas (PRWEB) April 24, 2015 ... for use in applications such as animal waste ... and oil reduction in wastewater treatment plants and ... an exhibitor at the National Restaurant Association’s NRA ... , Representatives of the company will be ...
(Date:4/24/2015)... 2015 PAREXEL International Corporation (NASDAQ: ... announced that Partnerships in Clinical Trials named PAREXEL,s ... Clinical Innovator of the Year.  The honor recognizes Mr. ... Company,s Perceptive MyTrials ® Data-Driven Monitoring solution. ... the 2015 Partnership Awards in Boston ...
(Date:4/23/2015)... 23, 2015 /CNW/ - A new and innovative service ... North America,s largest packaging ... Silver in the "Sustainability, service" category of the ... "Competitor Comparison" is a service that scores clients, ... Global peers. This benchmarking process shows clients how ...
(Date:4/23/2015)... April 23, 2015 Follow ... to a series of genetic tests that determine ... Lou Gehrig's disease, Huntington's disease, and Alzheimer's disease. ... gene composition and interaction in diseased tissue/cells to ... well as the response to treatment, such as ...
Breaking Biology Technology:DryLet to Showcase Bio-React at the National Restaurant Association’s NRA Show 2015 May 16-19, 2015 in Chicago, Illinois 2PAREXEL Honored With 2015 Clinical Innovator Of The Year Award From Partnerships In Clinical Trials 2PAREXEL Honored With 2015 Clinical Innovator Of The Year Award From Partnerships In Clinical Trials 3PAREXEL Honored With 2015 Clinical Innovator Of The Year Award From Partnerships In Clinical Trials 4PAREXEL Honored With 2015 Clinical Innovator Of The Year Award From Partnerships In Clinical Trials 5Increasing Disease Prevalence & Focus on Preventive Healthcare Drive the Predictive Diagnostics Market, According to a New Report by Global Industry Analysts, Inc. 2Increasing Disease Prevalence & Focus on Preventive Healthcare Drive the Predictive Diagnostics Market, According to a New Report by Global Industry Analysts, Inc. 3
... , ... • LEADseeker • DeepBlueC• cell-based assays , ... Competitive pressure is forcing organizations to continually increase screening ... screens such as luminescence cell-based assays. LEADseeker™ Multimodality Imaging System was ...
... , Key ... amplification (WGA),• degenerate oligonucleotideprimed PCR (DOP-PCR),• Cy3/Cy5-dCTP probe labeling ... array • array CGH ... Human genomic DNA isolated from formalin-fixed ...
... Amounts of Data into Gems of Knowledge Using discoveryHub™ ... Abstract , This paper discusses key problems and ... (volume) and complexity of life science data available today, ... integration that enables rapid ‘harvesting’ and analysis of critical ...
Cached Biology Technology:Use of BRET2 luminescence cell-based assays with LEADseeker Multimodality Imaging System 2Use of BRET2 luminescence cell-based assays with LEADseeker Multimodality Imaging System 3GenomiPhi amplification of FFPE tissue DNA for array CGH 2GenomiPhi amplification of FFPE tissue DNA for array CGH 3GenomiPhi amplification of FFPE tissue DNA for array CGH 4GenomiPhi amplification of FFPE tissue DNA for array CGH 5GenomiPhi amplification of FFPE tissue DNA for array CGH 6GenomiPhi amplification of FFPE tissue DNA for array CGH 7GenomiPhi amplification of FFPE tissue DNA for array CGH 8GenomiPhi amplification of FFPE tissue DNA for array CGH 9GenomiPhi amplification of FFPE tissue DNA for array CGH 10Exploiting the Life Science Data Explosion to Speed New Drug Discovery 2Exploiting the Life Science Data Explosion to Speed New Drug Discovery 3Exploiting the Life Science Data Explosion to Speed New Drug Discovery 4Exploiting the Life Science Data Explosion to Speed New Drug Discovery 5Exploiting the Life Science Data Explosion to Speed New Drug Discovery 6Exploiting the Life Science Data Explosion to Speed New Drug Discovery 7Exploiting the Life Science Data Explosion to Speed New Drug Discovery 8Exploiting the Life Science Data Explosion to Speed New Drug Discovery 9Exploiting the Life Science Data Explosion to Speed New Drug Discovery 10Exploiting the Life Science Data Explosion to Speed New Drug Discovery 11Exploiting the Life Science Data Explosion to Speed New Drug Discovery 12Exploiting the Life Science Data Explosion to Speed New Drug Discovery 13Exploiting the Life Science Data Explosion to Speed New Drug Discovery 14Exploiting the Life Science Data Explosion to Speed New Drug Discovery 15Exploiting the Life Science Data Explosion to Speed New Drug Discovery 16Exploiting the Life Science Data Explosion to Speed New Drug Discovery 17
(Date:3/24/2015)... BEACH GARDENS, Fla. , March 24, 2015 ... biometric identity management solutions, today announced that its ... premium clothing accessory retailer Goorin Bros . ... The Crossmatch biometrics-based solution secures access to the ... from the increased risk of data breaches. ...
(Date:3/23/2015)... OXFORD, Conn. , Mar. 23, 2015 NXT-ID, Inc. ... authentication company focused on the growing mobile commerce market, announces ... a new advertising campaign on CNBC television starting March 30 ... ads will commence airing in New York ... Executive Officer said: "We are excited about our new ad ...
(Date:3/20/2015)... 2015 Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) ... Global Strategic Business Report" report to their offering. ... in US$ Thousands. The report provides separate comprehensive analytics for ... , Europe , Asia-Pacific ... Latin America . Annual estimates and ...
Breaking Biology News(10 mins):Crossmatch Fingerprint Readers Help Retailer Prevent Data Breaches at Point-of-Sale 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... February 1, 2011. Fact: The sex of some species ... warm nests produce females, cooler nests, males. And although ... years, scientists now report that almost half of the turtle ... global warming may affect turtle reproduction. To bring attention to ...
... species present a serious environmental, economic and social problem ... biodiversity and ecosystem functions, such as nutrient cycling. Despite ... can dominate new habitats over native plants that technically ... tested assumption is that these plants are more abundant ...
... key to preventing deaths from measles. Despite the availability ... children worldwide, particularly in less-developed regions where vaccination coverage ... at the Johns Hopkins Bloomberg School of Public Health ... a dry powder, live-attenuated measles vaccine that can be ...
Cached Biology News:Turtle populations affected by climate, habitat loss and overexploitation 2Home and away: How do invasive plant species dominate native species? 2Researchers test inhalable measles vaccine 2
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products: