Navigation Links
Novavax Announces Closing of $18 Million Registered Direct Offering
Date:8/1/2008

ROCKVILLE, Md., Aug. 1 /PRNewswire-FirstCall/ -- Novavax, Inc. (Nasdaq: NVAX) announced today that it has completed the previously announced registered direct equity financing of $18 million by issuing common stock and warrants (the "units") from its existing shelf registration statement. The Company sold 6,686,650 units to certain current and new institutional shareholders and certain affiliates of the Company. Each unit was comprised of one share of common stock and a warrant to purchase 0.5 shares of common stock and was sold at a purchase price of $2.68 per unit (or $2.8425 per unit for units sold to affiliates of the Company). The warrants, which represent the right to acquire 3,343,325 shares of common stock, will be exercisable at a price of $3.62 per share and have a five year term. The Company completed the financing without using the services of a placement agent or underwriter. Net proceeds of the offering after expenses are expected to be $17.6 million.

The Company intends to use the proceeds from this offering for pre-clinical and clinical studies for its VLP-based vaccines, internal research and development programs, working capital, capital expenditures and other general corporate purposes.

This offering was made pursuant to an existing effective shelf registration statement and was made directly by the Company. A prospectus supplement and the accompanying base prospectus was filed with the Securities and Exchange Commission ("SEC") on July 29, 2008 and may be obtained at the SEC's website at http://www.sec.gov.

About Novavax

Novavax, Inc. is a clinical-stage biotechnology company creating novel vaccines to address a broad range of infectious diseases worldwide using advanced proprietary virus-like particle (VLP) technology. The Company creates VLPs by genetically engineering three-dimensional, nanostructures, which incorporate immunologically important lipids and recomb
'/>"/>

SOURCE Novavax, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Novavax CEO to Present at BIO CEO & Investor Conference
2. Novavax Enters Into Estrasorb(R) Asset Sale and Supply Agreements with Graceway Pharmaceuticals, LLC
3. Graceway Pharmaceuticals, LLC(TM) Announces Completed Acquisition of All Assets Related to Estrasorb(R) Product Line in North America From Allergan, Inc. (NYSE: AGN) and Novavax, Inc. (Nasdaq: NVAX)
4. Novavax CEO to Present at the World Vaccine Congress 2008
5. Novavax Opens Its First U.S. Vaccine Plant
6. Novavax Announces Release Date of 2008 First Quarter Financial Results and Investor Conference Call
7. Novavax Reports First Quarter 2008 Financial Results
8. Novavax CEO to Present at ACUMENBioFins 5th Annual Global Healthcare Conference
9. Novavax CEO to Present at FBR Capital Markets 12th Annual Spring Investor Conference
10. Novavax CEO to Present at Piper Jaffray Europe Conference, London, UK
11. Novavax to Join Russell 3000 Index
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/30/2015)... SAN DIEGO , June 30, 2015 /PRNewswire/ ... Continuing Education in Biosciences (CCE/Bio) and UC San ... microbial fermentation, to be held Aug.  12 – ... agenda ).  This three-day workshop provides an intense ... in industrial biotechnology, and is well-suited to biologists, ...
(Date:6/30/2015)... VANCOUVER , June 30, 2015 /PRNewswire/ - ... a clinical stage regenerative medicine company focused on ... the first participant in its Phase 1/2 clinical ... of chronic unilateral Achilles tendinosis, has been enrolled ... to intra-tendon ultrasound-guided injections. RCT-01 is comprised of ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... has accepted the position of vice president of instruction at Chippewa Valley Technical ... “I greatly appreciated the opportunity to lead SIUE during the past three years,” ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... launched “Cannavoices,” an unprecedented digital video and broadcast initiative. Produced by filmmakers, the ... dynamic collection of legal medical cannabis stories ever assembled. , Cannavoices profiles ...
Breaking Biology Technology:UC San Diego Extension to Offer Third Annual Microbial Fermentation Workshop 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 3RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 4SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 2SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 3Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3
... Corporation, a boutique investment bank specializing in at-the-market (ATM) offerings, ... $25 million through activity of nine ATM offerings of common ... While the data represent a 60 percent decrease in ... to the second quarter of 2011, this reduction in gross ...
... 13, 2011   Cellular Dynamics International (CDI) today ... for use in neuroscience drug discovery, neurotoxicity screens, ... availability of human neurons, or brain cells, created from ... and purity required for life science research. ...
... confirmed that it is planning to submit a New ... (FDA) in the second half of 2012 for OSTORA™, ... treatment of postmenopausal osteoporosis. This follows a formal pre-NDA dialogue ... Phase III ORACAL trial and the requirements for regulatory ...
Cached Biology Technology:At-the-Market Offerings (ATM) of Life Sciences Companies Perform Well in Weak Follow-on Financing Environment of Third Quarter 2At-the-Market Offerings (ATM) of Life Sciences Companies Perform Well in Weak Follow-on Financing Environment of Third Quarter 3Cellular Dynamics Announces Commercial Launch of iCell® Neurons for Neuroscience Drug Discovery 2Cellular Dynamics Announces Commercial Launch of iCell® Neurons for Neuroscience Drug Discovery 3Tarsa Therapeutics Targets 2012 NDA Submission for its OSTORA™ Oral Calcitonin 2Tarsa Therapeutics Targets 2012 NDA Submission for its OSTORA™ Oral Calcitonin 3
(Date:6/29/2015)... 2015 Research and Markets( ... "Latin America Biomedical Sensors Market - Growth, Trends & ... The Latin America Biomedical Sensors market is estimated at ... over the period 2014-2020 The near future ... genetic formulation of each individual. These sensors can be ...
(Date:6/25/2015)...  Imagine a tool specifically designed to help you ... That,s exactly what USANA,s True Health Assessment ... health program provides a personalized approached to measuring your ... lifestyle and nutrition. At the Canadian ... USANA,s THA was honored with the Industry Innovation Award. ...
(Date:6/24/2015)... NEW YORK , June 24, 2015 ... Systems market, over the next six years. It contains ... affect the industry, along with their impact from the ... It also discusses the industry, market, and technology ... expected that the need of concerned authorities to efficiently ...
Breaking Biology News(10 mins):Latin America Biomedical Sensors Market Report 2015-2020 2@USANAinc's Personalized Nutrition Program Wins Industry Innovation Award 2Automatic Identification System Market by Class, by Platform, by Application and by Geography - Global Forecasts & Analysis to 2014 - 2020 2
... Sieh, a PhD student at IHBI, is studying the ... bloodstream to form tumour colonies, most often in the ... study which uses a tissue engineering platform technology developed ... investigate the interaction between bones and cancer cells," Ms ...
... available in Spanish . , A team ... of the University of Navarra has identified a key enzyme ... in the accumulation of fibrous tissues in the hearts of ... The research project, published in the journal Hypertension ...
... WALL, N.J., April 21 BIO-key International, Inc. ... biometric identification and wireless public safety solutions announced ... biometric products at the 2009 RSA Conference Exposition. ... at the Moscone Conference Center on April 21st ...
Cached Biology News:3-D research model tackles prostate cancer spread 2Researchers identify a molecule that increases the risk of cardiac insufficiency 2BIO-key(R) International Showcasing Biometric Identification Technology at 2009 RSA Conference 2BIO-key(R) International Showcasing Biometric Identification Technology at 2009 RSA Conference 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: