Navigation Links
New nanostructured thin film shows promise for efficient solar energy conversion
Date:1/8/2008

SANTA CRUZ, CA--In the race to make solar cells cheaper and more efficient, many researchers and start-up companies are betting on new designs that exploit nanostructures--materials engineered on the scale of a billionth of a meter. Using nanotechnology, researchers can experiment with and control how a material generates, captures, transports, and stores free electrons--properties that are important for the conversion of sunlight into electricity.

Two nanotech methods for engineering solar cell materials have shown particular promise. One uses thin films of metal oxide nanoparticles, such as titanium dioxide, doped with other elements, such as nitrogen. Another strategy employs quantum dots--nanosize crystals--that strongly absorb visible light. These tiny semiconductors inject electrons into a metal oxide film, or "sensitize" it, to increase solar energy conversion. Both doping and quantum dot sensitization extend the visible light absorption of the metal oxide materials.

Combining these two approaches appears to yield better solar cell materials than either one alone does, according to Jin Zhang, professor of chemistry at the University of California, Santa Cruz. Zhang led a team of researchers from California, Mexico, and China that created a thin film doped with nitrogen and sensitized with quantum dots. When tested, the new nanocomposite material performed better than predicted--as if the functioning of the whole material was greater than the sum of its two individual components.

"We have discovered a new strategy that could be very useful for enhancing the photo response and conversion efficiency of solar cells based on nanomaterials," said Zhang.

"We initially thought that the best we might do is get results as good as the sum of the two, and maybe if we didn't make this right, we'd get something worse. But surprisingly, these materials were much better."

The group's findings were reported in the Journal of Ph
'/>"/>

Contact: Tim Stephens
stephens@ucsc.edu
831-459-2495
University of California - Santa Cruz
Source:Eurekalert

Page: 1 2 3

Related biology technology :

1. NIST team develops novel method for nanostructured polymer thin films
2. Federally-Funded Study Shows More Women Can Avoid Hysterectomy for Common Problem
3. What To Do When a Holiday Guest Shows Up With a Pet
4. Kosans Hsp90 Inhibitor, Tanespimycin, Shows 55% Clinical Benefit in Patients With Trastuzumab-Refractory Metastatic Breast Cancer
5. National Survey Shows Most Women Are Not Satisfied With Their Progesterone Treatment
6. Video shows buckyballs form by shrink wrapping
7. Celator(R) Pharmaceuticals Study Shows CPX-571 Maintains Synergistic Ratio of Irinotecan and Cisplatin to Improve Anti-tumor Activity
8. New Oral MEK Inhibitor, RDEA119, Shows Favorable Anti-Tumor Properties
9. Aidas Rh-Apo2L Clinical Testing Shows Preliminary Efficacy in Helping to Treat Lung Cancer, Stomach Cancer, Lymphoma, Pancreatic Cancer & Kidney Cancer
10. International Survey Shows People Over Forty Ignore Risk of Blindness
11. New Study Shows Promise for Hydrogen Sulfide in Reducing Heart-Attack Damage, Ikaria Announces
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: