Navigation Links
New Torrent Suite Software Provides Highest Accuracy and 400 Base Pair Kits Deliver Broader Applications for Ion Semiconductor Sequencing
Date:9/6/2012

CARLSBAD, Calif., Sept. 6, 2012 /PRNewswire/ -- Life Technologies Corporation (NASDAQ: LIFE) today announced another major advancement in the performance trajectory of its Ion AmpliSeq Technology. The new Torrent Suite Software v3.0 now consistently delivers 99.99+% consensus accuracy for both short and long homopolymer regions, and increases the frequency of correctly called insertions, deletions and homopolymer sequences by two-fold.

Read length on the Ion PGM™ also continues its unprecedented scalability with today's launch of the 400 base sequencing kits, which will provide a broader range of applications, such as bacterial identification, metagenomic analysis, Human Leukocyte Antigen sequencing, and better de novo assemblies.

"Ion's new long read kits combined with accuracy increases from Torrent Suite v3.0 have enabled us to significantly improve the performance of our bacterial and metagenomic sequencing as well as microbial genome assemblies," said Professor Dag Harmsen of the University of Muenster, Germany – a researcher at the epicenter of last year's pathogenic E coli outbreak. "The rapid generation of long accurate reads by the Ion PGM Sequencer will truly enable the new science of prospective genomic epidemiology."

AmpliSeq™ Technology Transforms Research

Six months after its introduction to the market, Ion AmpliSeq Technology has significantly transformed the way hypothesis-driven research is conducted. More than 700 customers have completed over 2,500 gene panel designs and high throughput laboratories have achieved annual run rates of over 1,000 runs per Ion PGM System.  

A new Ion AmpliSeq Sample ID Panel reveals sample misidentification to increase conf
'/>"/>

SOURCE Life Technologies
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Life Technologies to Accelerate Development of Ion Torrent Semiconductor Technology for Proteomic Applications in Research, Applied and Clinical Markets
2. BioLife Solutions Completes Corporate Facilities Expansion, Build-Out of Additional cGMP Clean Room Manufacturing Suite
3. Nitor Group Demonstrates Direct Product Suite at Direct Implementation and Adoption Summit May 31-June 1
4. ValGenesis Suite 2.5 Certified by SAP as Powered by SAP NetWeaver®
5. Glencoe Software and The Journal of Cell Biology Pioneer Publishing of Massive, Ultra-Resolution Images
6. Hyland Software hosts annual user forum for ECM, EMR software
7. RURO Adds Critical Level Monitoring Functionality to its Inventory Management Software FreezerPro.
8. Roche 454 Life Sciences and SoftGenetics Sign Co-Promotion Agreement for Next-Gen Sequencing Software Tools
9. Pharmaceutical Consortium Selects BioFortis Software to Manage Collaborative Clinical Data and Biobanking Activities
10. New Software from SRI Speeds Development of Genome-Scale Models for Drug and Fuel Research
11. Number of Ion Community Users Triples, Spurred by Open Access to DNA Sequencing Protocols and Analysis Software
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: